bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_1288_orf1 Length=169 Score E Sequences producing significant alignments: (Bits) Value tpv:TP02_0678 eukaryotic translation initiation factor 2 subun... 158 9e-39 tgo:TGME49_035540 translation initiation factor 2 beta, putati... 149 3e-36 cpv:cgd8_4430 translation initiation factor if-2 betam beta su... 145 5e-35 bbo:BBOV_II007040 18.m06583; eukaryotic translation initiation... 142 4e-34 pfa:PF10_0103 eukaryotic translation initiation factor 2 beta,... 135 7e-32 mmu:67204 Eif2s2, 2810026E11Rik, 38kDa, AA408636, AA571381, AA... 91.7 1e-18 mmu:100040220 Gm9892; predicted gene 9892 91.7 hsa:8894 EIF2S2, DKFZp686L18198, EIF2, EIF2B, EIF2beta, MGC850... 91.3 1e-18 xla:779195 hypothetical protein MGC130708 90.5 2e-18 dre:324365 eif2s2, wu:fc26g03, wu:fu10f07, zgc:77084; eukaryot... 90.1 3e-18 xla:779197 eif2s2, MGC130959; eukaryotic translation initiatio... 90.1 4e-18 xla:780741 eukaryote initiation factor 2 beta 90.1 4e-18 ath:AT5G20920 EIF2 BETA; translation initiation factor; K03238... 88.6 9e-18 cel:K04G2.1 iftb-1; eIFTwoBeta (eIF2beta translation initiatio... 81.6 1e-15 ath:AT3G07920 translation initiation factor; K03238 translatio... 65.9 7e-11 sce:YPL237W SUI3; Beta subunit of the translation initiation f... 62.0 8e-10 ath:AT5G01940 eukaryotic translation initiation factor 2B fami... 49.7 4e-06 xla:443810 rcc1-b, MGC115703, MGC132085, RanGEF, chc1, chc1-b,... 32.3 0.76 cel:Y71D11A.1 cdh-12; CaDHerin family member (cdh-12) 30.8 2.4 sce:YHR013C ARD1, NAA10; Ard1p (EC:2.3.1.88); K00670 peptide a... 29.3 6.0 tgo:TGME49_114740 splicing factor 3B subunit 2, putative ; K12... 29.3 6.8 ath:AT5G61620 myb family transcription factor 28.9 8.0 > tpv:TP02_0678 eukaryotic translation initiation factor 2 subunit beta; K03238 translation initiation factor 2 subunit 2 Length=241 Score = 158 bits (399), Expect = 9e-39, Method: Compositional matrix adjust. Identities = 73/112 (65%), Positives = 88/112 (78%), Gaps = 5/112 (4%) Query 12 FDFGERRKKKKEKKPEDQAAEAASEAFVDGSGQLFVRGHVYSYEEMLKRIQELIVRNNPD 71 F+FGE++KK+ A ++ +DG+GQ+FV+GHVY YEE+L RIQ +I NNPD Sbjct 49 FNFGEKKKKRTV-----DAGDSPKTEIIDGTGQVFVKGHVYPYEELLARIQSMINANNPD 103 Query 72 LAGSKRYTIKPPQVVRVGSKKVAWINFKDICGIMHRPSEHVLQFVLAELGTE 123 L+GSKRYTIKPPQVVRVGSKKVAWINF+DIC IM R +HV QFVLAELGTE Sbjct 104 LSGSKRYTIKPPQVVRVGSKKVAWINFRDICSIMGRSMDHVHQFVLAELGTE 155 > tgo:TGME49_035540 translation initiation factor 2 beta, putative ; K03238 translation initiation factor 2 subunit 2 Length=231 Score = 149 bits (377), Expect = 3e-36, Method: Compositional matrix adjust. Identities = 83/122 (68%), Positives = 98/122 (80%), Gaps = 3/122 (2%) Query 4 AEHRAAQAFDFGERRKKKKEKKPED-QAAEAASEAFVDGSGQLFVRGHVYSYEEMLKRIQ 62 E A Q FDFGERR++KK++K E QA E A +DG+G+LF RG YSY+EML+RIQ Sbjct 26 GEEEAPQQFDFGERRRRKKKEKKETEQAQEEAP--IIDGTGELFKRGKEYSYQEMLQRIQ 83 Query 63 ELIVRNNPDLAGSKRYTIKPPQVVRVGSKKVAWINFKDICGIMHRPSEHVLQFVLAELGT 122 LI ++NPDL+G+KRYTIKPPQVVRVGSKKVAWINFKDIC IM+R +HV QFVLAELGT Sbjct 84 TLIEKHNPDLSGAKRYTIKPPQVVRVGSKKVAWINFKDICNIMNRQPDHVHQFVLAELGT 143 Query 123 ES 124 E Sbjct 144 EG 145 > cpv:cgd8_4430 translation initiation factor if-2 betam beta subunit ZnR ; K03238 translation initiation factor 2 subunit 2 Length=214 Score = 145 bits (367), Expect = 5e-35, Method: Compositional matrix adjust. Identities = 72/114 (63%), Positives = 95/114 (83%), Gaps = 1/114 (0%) Query 11 AFDFGERRKKKKEKKPEDQAAEAASEAFVDGSGQLFVRGHVYSYEEMLKRIQELIVRNNP 70 +DFGE++KKKK K+ + +E S ++VDGSGQLFV+G +Y YEE+L+R++ LI+ +NP Sbjct 16 GYDFGEKKKKKKSKEHKTGVSEVES-SYVDGSGQLFVKGAIYPYEELLERVRRLILEHNP 74 Query 71 DLAGSKRYTIKPPQVVRVGSKKVAWINFKDICGIMHRPSEHVLQFVLAELGTES 124 DL G+KRYT+KPPQVVRVGSKKVAWINF++IC IM R ++HV QFVL+ELGTE Sbjct 75 DLWGAKRYTLKPPQVVRVGSKKVAWINFQEICNIMQRNADHVFQFVLSELGTEG 128 > bbo:BBOV_II007040 18.m06583; eukaryotic translation initiation factor 2, beta; K03238 translation initiation factor 2 subunit 2 Length=238 Score = 142 bits (359), Expect = 4e-34, Method: Compositional matrix adjust. Identities = 72/123 (58%), Positives = 91/123 (73%), Gaps = 5/123 (4%) Query 1 AQPAEHRAAQAFDFGERRKKKKEKKPEDQAAEAASEAFVDGSGQLFVRGHVYSYEEMLKR 60 A + A +DFGE++KKK A+++ +DGSGQ+FVRGHVY YEE+L R Sbjct 35 AAAVKAEGAPKYDFGEKKKKKAAP-----ASDSVKSEVIDGSGQVFVRGHVYQYEELLNR 89 Query 61 IQELIVRNNPDLAGSKRYTIKPPQVVRVGSKKVAWINFKDICGIMHRPSEHVLQFVLAEL 120 IQ LI ++ DL+G+K+YTI+PPQVVRVGSKKVAWINFK++C IM R +HV QFVLAEL Sbjct 90 IQTLINAHSHDLSGNKKYTIRPPQVVRVGSKKVAWINFKELCNIMGRTMDHVHQFVLAEL 149 Query 121 GTE 123 GTE Sbjct 150 GTE 152 > pfa:PF10_0103 eukaryotic translation initiation factor 2 beta, putative; K03238 translation initiation factor 2 subunit 2 Length=222 Score = 135 bits (340), Expect = 7e-32, Method: Compositional matrix adjust. Identities = 74/115 (64%), Positives = 89/115 (77%), Gaps = 4/115 (3%) Query 10 QAFDFGERRKKKKEKKPEDQAAEAASEAFVDGSGQLFVRGHVYSYEEMLKRIQELIVRNN 69 Q FDFGE++KKKK+K + E E +DG+G++F RG VY Y+E+L RIQ+LI ++N Sbjct 25 QLFDFGEKKKKKKKK----EVVEKVEEIIIDGTGKVFERGAVYPYDELLHRIQDLINKHN 80 Query 70 PDLAGSKRYTIKPPQVVRVGSKKVAWINFKDICGIMHRPSEHVLQFVLAELGTES 124 DL SK+YTIKPPQVVRVGSKKVAWINFKDIC IM+R EHV FVLAELGTE Sbjct 81 IDLCISKKYTIKPPQVVRVGSKKVAWINFKDICTIMNRNEEHVFHFVLAELGTEG 135 > mmu:67204 Eif2s2, 2810026E11Rik, 38kDa, AA408636, AA571381, AA986487, AW822225, D2Ertd303e, EIF2, EIF2B, MGC130606; eukaryotic translation initiation factor 2, subunit 2 (beta); K03238 translation initiation factor 2 subunit 2 Length=331 Score = 91.7 bits (226), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 40/73 (54%), Positives = 57/73 (78%), Gaps = 2/73 (2%) Query 52 YSYEEMLKRIQELIVRNNPDL-AGSKR-YTIKPPQVVRVGSKKVAWINFKDICGIMHRPS 109 Y+YEE+L R+ ++ NPD+ AG KR + +KPPQVVRVG+KK +++NF DIC ++HR Sbjct 172 YTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQP 231 Query 110 EHVLQFVLAELGT 122 +H+L F+LAELGT Sbjct 232 KHLLAFLLAELGT 244 > mmu:100040220 Gm9892; predicted gene 9892 Length=331 Score = 91.7 bits (226), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 39/73 (53%), Positives = 57/73 (78%), Gaps = 2/73 (2%) Query 52 YSYEEMLKRIQELIVRNNPDL-AGSKR-YTIKPPQVVRVGSKKVAWINFKDICGIMHRPS 109 Y+YEE+L R+ ++ NPD+ AG KR + +KPPQV+RVG+KK +++NF DIC ++HR Sbjct 172 YTYEELLNRVLNIMREKNPDMVAGEKRKFVMKPPQVIRVGTKKTSFVNFTDICKLLHRQP 231 Query 110 EHVLQFVLAELGT 122 +H+L F+LAELGT Sbjct 232 KHLLAFLLAELGT 244 > hsa:8894 EIF2S2, DKFZp686L18198, EIF2, EIF2B, EIF2beta, MGC8508; eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa; K03238 translation initiation factor 2 subunit 2 Length=333 Score = 91.3 bits (225), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 40/73 (54%), Positives = 57/73 (78%), Gaps = 2/73 (2%) Query 52 YSYEEMLKRIQELIVRNNPDL-AGSKR-YTIKPPQVVRVGSKKVAWINFKDICGIMHRPS 109 Y+YEE+L R+ ++ NPD+ AG KR + +KPPQVVRVG+KK +++NF DIC ++HR Sbjct 174 YTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQP 233 Query 110 EHVLQFVLAELGT 122 +H+L F+LAELGT Sbjct 234 KHLLAFLLAELGT 246 > xla:779195 hypothetical protein MGC130708 Length=332 Score = 90.5 bits (223), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 39/73 (53%), Positives = 57/73 (78%), Gaps = 2/73 (2%) Query 52 YSYEEMLKRIQELIVRNNPDL-AGSKR-YTIKPPQVVRVGSKKVAWINFKDICGIMHRPS 109 Y+Y+E+L R+ ++ NPD+ AG KR + +KPPQVVRVG+KK +++NF DIC ++HR Sbjct 173 YTYDELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQP 232 Query 110 EHVLQFVLAELGT 122 +H+L F+LAELGT Sbjct 233 KHLLAFLLAELGT 245 > dre:324365 eif2s2, wu:fc26g03, wu:fu10f07, zgc:77084; eukaryotic translation initiation factor 2, subunit 2 beta; K03238 translation initiation factor 2 subunit 2 Length=327 Score = 90.1 bits (222), Expect = 3e-18, Method: Compositional matrix adjust. Identities = 39/73 (53%), Positives = 57/73 (78%), Gaps = 2/73 (2%) Query 52 YSYEEMLKRIQELIVRNNPDL-AGSKR-YTIKPPQVVRVGSKKVAWINFKDICGIMHRPS 109 Y+Y+E+L R+ ++ NPD+ AG KR + +KPPQVVRVG+KK +++NF DIC ++HR Sbjct 168 YTYDELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQP 227 Query 110 EHVLQFVLAELGT 122 +H+L F+LAELGT Sbjct 228 KHLLVFLLAELGT 240 > xla:779197 eif2s2, MGC130959; eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa; K03238 translation initiation factor 2 subunit 2 Length=335 Score = 90.1 bits (222), Expect = 4e-18, Method: Compositional matrix adjust. Identities = 39/73 (53%), Positives = 57/73 (78%), Gaps = 2/73 (2%) Query 52 YSYEEMLKRIQELIVRNNPDL-AGSKR-YTIKPPQVVRVGSKKVAWINFKDICGIMHRPS 109 Y+Y+E+L R+ ++ NPD+ AG KR + +KPPQVVRVG+KK +++NF DIC ++HR Sbjct 176 YTYDELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQP 235 Query 110 EHVLQFVLAELGT 122 +H+L F+LAELGT Sbjct 236 KHLLAFLLAELGT 248 > xla:780741 eukaryote initiation factor 2 beta Length=335 Score = 90.1 bits (222), Expect = 4e-18, Method: Compositional matrix adjust. Identities = 39/73 (53%), Positives = 57/73 (78%), Gaps = 2/73 (2%) Query 52 YSYEEMLKRIQELIVRNNPDL-AGSKR-YTIKPPQVVRVGSKKVAWINFKDICGIMHRPS 109 Y+Y+E+L R+ ++ NPD+ AG KR + +KPPQVVRVG+KK +++NF DIC ++HR Sbjct 176 YTYDELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQP 235 Query 110 EHVLQFVLAELGT 122 +H+L F+LAELGT Sbjct 236 KHLLAFLLAELGT 248 > ath:AT5G20920 EIF2 BETA; translation initiation factor; K03238 translation initiation factor 2 subunit 2 Length=268 Score = 88.6 bits (218), Expect = 9e-18, Method: Compositional matrix adjust. Identities = 37/72 (51%), Positives = 55/72 (76%), Gaps = 1/72 (1%) Query 52 YSYEEMLKRIQELIVRNNPDLAGSKRYTI-KPPQVVRVGSKKVAWINFKDICGIMHRPSE 110 Y Y+E+L R+ ++ NNP+LAG +R T+ +PPQV+R G+KK ++NF D+C MHR + Sbjct 116 YIYDELLGRVFNILRENNPELAGDRRRTVMRPPQVLREGTKKTVFVNFMDLCKTMHRQPD 175 Query 111 HVLQFVLAELGT 122 HV+Q++LAELGT Sbjct 176 HVMQYLLAELGT 187 > cel:K04G2.1 iftb-1; eIFTwoBeta (eIF2beta translation initiation factor) family member (iftb-1); K03238 translation initiation factor 2 subunit 2 Length=250 Score = 81.6 bits (200), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 38/72 (52%), Positives = 51/72 (70%), Gaps = 1/72 (1%) Query 52 YSYEEMLKRIQELIVRNNPDLAGSKR-YTIKPPQVVRVGSKKVAWINFKDICGIMHRPSE 110 Y+YEE L + +++ NPD AG K+ + IK P+V R GSKK A+ NF +IC +M R + Sbjct 87 YTYEEALTLVYQVMKDKNPDFAGDKKKFAIKLPEVARAGSKKTAFSNFLEICRLMKRQDK 146 Query 111 HVLQFVLAELGT 122 HVLQF+LAELGT Sbjct 147 HVLQFLLAELGT 158 > ath:AT3G07920 translation initiation factor; K03238 translation initiation factor 2 subunit 2 Length=164 Score = 65.9 bits (159), Expect = 7e-11, Method: Compositional matrix adjust. Identities = 33/73 (45%), Positives = 48/73 (65%), Gaps = 5/73 (6%) Query 55 EEMLKRIQELIVRNNPDLAGSKRYTIK-PPQVVRV----GSKKVAWINFKDICGIMHRPS 109 +E+L+R+ ++ N+P+L G TI PPQV+R G+KK ++NF D C MHR Sbjct 17 QEILRRVFNILRENSPELVGIWLLTIIWPPQVLREETAKGTKKTVFVNFMDYCKTMHRNP 76 Query 110 EHVLQFVLAELGT 122 +HV+ F+LAELGT Sbjct 77 DHVMAFLLAELGT 89 > sce:YPL237W SUI3; Beta subunit of the translation initiation factor eIF2, involved in the identification of the start codon; proposed to be involved in mRNA binding; K03238 translation initiation factor 2 subunit 2 Length=285 Score = 62.0 bits (149), Expect = 8e-10, Method: Compositional matrix adjust. Identities = 35/92 (38%), Positives = 51/92 (55%), Gaps = 15/92 (16%) Query 54 YEEMLKRIQELIVRNNPDLAGSK---RYTIKPPQVVRVGSKKVAWINFKDICGIMHRPSE 110 Y E+L R ++ NNP+LAG + ++ I PP +R G KK + N +DI +HR E Sbjct 131 YSELLSRFFNILRTNNPELAGDRSGPKFRIPPPVCLRDG-KKTIFSNIQDIAEKLHRSPE 189 Query 111 HVLQFVLAELGTESPQSNRPPKHLTSVKGEKR 142 H++Q++ AELGT SV G+KR Sbjct 190 HLIQYLFAELGTSG-----------SVDGQKR 210 > ath:AT5G01940 eukaryotic translation initiation factor 2B family protein / eIF-2B family protein; K03238 translation initiation factor 2 subunit 2 Length=231 Score = 49.7 bits (117), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 23/72 (31%), Positives = 45/72 (62%), Gaps = 2/72 (2%) Query 52 YSYEEMLKRIQELIVRNNPDLAGSK-RYTIKPPQVVRVGSKKVAWINFKDICGIMHRPSE 110 Y Y+E+L + + + + +++ + R + PPQ++ G+ V +NF D+C MHR + Sbjct 73 YGYKELLSMVFDRLREEDVEVSTERPRTVMMPPQLLAEGTITVC-LNFADLCRTMHRKPD 131 Query 111 HVLQFVLAELGT 122 HV++F+LA++ T Sbjct 132 HVMKFLLAQMET 143 > xla:443810 rcc1-b, MGC115703, MGC132085, RanGEF, chc1, chc1-b, rcc1, xrcc1; regulator of chromosome condensation 1; K11493 regulator of chromosome condensation Length=420 Score = 32.3 bits (72), Expect = 0.76, Method: Compositional matrix adjust. Identities = 21/64 (32%), Positives = 35/64 (54%), Gaps = 8/64 (12%) Query 83 PQVVRVGSKKVAWINFKDI-CGIMHRPS----EHVLQFVLA---ELGTESPQSNRPPKHL 134 PQ + + +K ++F+D+ CG + HV F L+ +LGT++ QS P++L Sbjct 228 PQCIHLKAKGSGRVHFQDVFCGAYFTFAVSQEGHVFGFGLSNYHQLGTKTTQSCYAPQNL 287 Query 135 TSVK 138 TS K Sbjct 288 TSFK 291 > cel:Y71D11A.1 cdh-12; CaDHerin family member (cdh-12) Length=2922 Score = 30.8 bits (68), Expect = 2.4, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Query 5 EHRAAQAFDFGERRKKKKEKKPEDQA-AEAASEAFVDGSGQ 44 + +++Q R + KK K+PED+A ++ +E VDG+GQ Sbjct 667 KKQSSQEVGGASRSEDKKTKEPEDEAESDTVTEKKVDGAGQ 707 > sce:YHR013C ARD1, NAA10; Ard1p (EC:2.3.1.88); K00670 peptide alpha-N-acetyltransferase [EC:2.3.1.88] Length=238 Score = 29.3 bits (64), Expect = 6.0, Method: Compositional matrix adjust. Identities = 14/48 (29%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Query 108 PSEHVLQFVLAELGTESPQSNRPPK-HLTSVKGEKRKRKRSQKTRLLR 154 P E ++ +VL ++ + Q N PP H+TS+ + R+ L+R Sbjct 88 PGEKLVGYVLVKMNDDPDQQNEPPNGHITSLSVMRTYRRMGIAENLMR 135 > tgo:TGME49_114740 splicing factor 3B subunit 2, putative ; K12829 splicing factor 3B subunit 2 Length=743 Score = 29.3 bits (64), Expect = 6.8, Method: Compositional matrix adjust. Identities = 32/114 (28%), Positives = 46/114 (40%), Gaps = 17/114 (14%) Query 29 QAAEAASEA-FVDGSGQLFVRGHVYSYEEMLKRIQELIVRNNPDLAGS-----KRYTIKP 82 QA A E F++G L G S L +R PD A S K YTI Sbjct 511 QAGVAGGETPFLEGISSL---GGATSLSSGLDSPASFDLRRRPDGASSVASSAKPYTILT 567 Query 83 PQVVRVGSKKVAWINFKDICGIMHRPSEHVLQFVLAELGTESPQSNRPPKHLTS 136 PQ V VG ++ + G+ H + + + GT +P + P++L S Sbjct 568 PQDVPVGQQQ------GQLFGVKH--TYKIPSTLPGNAGTATPSGHLTPRNLLS 613 > ath:AT5G61620 myb family transcription factor Length=317 Score = 28.9 bits (63), Expect = 8.0, Method: Compositional matrix adjust. Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 2/58 (3%) Query 7 RAAQAFDFGERRKKKKEKKPEDQAAEAASEAFVDGSGQLFVRGHVYSYEEMLKRIQEL 64 R A FD +K+KE+ +D + + + + G Q V+GH + E+ R Q L Sbjct 165 RRASLFDISLEDQKEKERNSQDASTKTPPKQPITGIQQPVVQGHTQT--EISNRFQNL 220 Lambda K H 0.317 0.132 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 4222647260 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40