bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_1434_orf1 Length=211 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_022000 ribosome biogenesis protein Brix, putative ;... 62.8 1e-09 cpv:cgd4_1520 Brx1p nucleolar protein required for biogenesis ... 49.3 9e-06 pfa:PF07_0122 nucleolus BRIX protein, putative; K14820 ribosom... 41.2 0.003 bbo:BBOV_IV009420 23.m05729; ribosome biogenesis Brix protein;... 37.4 0.038 mmu:225115 Svil, AU024053, B430302E16Rik; supervillin; K10369 ... 32.0 1.5 tgo:TGME49_072470 protein kinase, putative (EC:2.7.11.1 3.4.21... 30.0 6.0 > tgo:TGME49_022000 ribosome biogenesis protein Brix, putative ; K14820 ribosome biogenesis protein BRX1 Length=517 Score = 62.8 bits (151), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 27/33 (81%), Positives = 30/33 (90%), Gaps = 0/33 (0%) Query 179 AAADPYLLEDAEYLRRETRWLNRQRVLVLGSRG 211 A ADPYLL +A+YLRRE RW+NRQRVLVLGSRG Sbjct 209 APADPYLLAEADYLRREKRWVNRQRVLVLGSRG 241 > cpv:cgd4_1520 Brx1p nucleolar protein required for biogenesis of the 60S ribosomal subunit ; K14820 ribosome biogenesis protein BRX1 Length=353 Score = 49.3 bits (116), Expect = 9e-06, Method: Compositional matrix adjust. Identities = 22/56 (39%), Positives = 35/56 (62%), Gaps = 3/56 (5%) Query 159 SAENDAAADAAD---SAAAIDAAAAADPYLLEDAEYLRRETRWLNRQRVLVLGSRG 211 S +N+ D + ++ + DPY+++ AEYL +E+RW N+QRVLVL +RG Sbjct 22 SEDNEIKMDIEEGHITSNNNNNNINTDPYMMKGAEYLNKESRWKNKQRVLVLSTRG 77 > pfa:PF07_0122 nucleolus BRIX protein, putative; K14820 ribosome biogenesis protein BRX1 Length=416 Score = 41.2 bits (95), Expect = 0.003, Method: Compositional matrix adjust. Identities = 16/28 (57%), Positives = 22/28 (78%), Gaps = 0/28 (0%) Query 182 DPYLLEDAEYLRRETRWLNRQRVLVLGS 209 DPYLL+DA Y+++ W NRQRVL++ S Sbjct 144 DPYLLKDASYIKKNELWKNRQRVLIVRS 171 > bbo:BBOV_IV009420 23.m05729; ribosome biogenesis Brix protein; K14820 ribosome biogenesis protein BRX1 Length=281 Score = 37.4 bits (85), Expect = 0.038, Method: Compositional matrix adjust. Identities = 13/33 (39%), Positives = 24/33 (72%), Gaps = 0/33 (0%) Query 179 AAADPYLLEDAEYLRRETRWLNRQRVLVLGSRG 211 DPY L+DA Y+++ +++ N+++ +VL SRG Sbjct 71 VNLDPYRLKDAYYIKQNSKYTNKKKCMVLASRG 103 > mmu:225115 Svil, AU024053, B430302E16Rik; supervillin; K10369 supervillin Length=2170 Score = 32.0 bits (71), Expect = 1.5, Method: Compositional matrix adjust. Identities = 42/144 (29%), Positives = 61/144 (42%), Gaps = 25/144 (17%) Query 19 EVAAAAQKAAGATPEAAAAAIQEATKKAPKALGKRP-ASSAKGECGAPATTSFRKRPRKQ 77 EVAA ATP A QE++++ + L K P A A GE P SF P K Sbjct 1024 EVAARKASVQMATP--GAWKQQESSEQLAEKLFKNPCAMFASGEVKVPVGDSFLDSPSKT 1081 Query 78 GRLRQ-----EKQQPEQQPPRAD----------GVHRQEDEHGNKKRRRQQQQQHQVH-Q 121 +++ +K E R G+H QE E KK+R + ++ Q+ + Sbjct 1082 MSIKERLALLKKSGEEDWKNRLIRKQEYGKATGGLHTQEVEQSLKKKRVTESRESQMTIE 1141 Query 122 DRNQTTDM------GKGEGAASDS 139 +R + KG GAA+DS Sbjct 1142 ERKHLITVREEAWKTKGRGAANDS 1165 > tgo:TGME49_072470 protein kinase, putative (EC:2.7.11.1 3.4.21.10) Length=1734 Score = 30.0 bits (66), Expect = 6.0, Method: Compositional matrix adjust. Identities = 33/129 (25%), Positives = 52/129 (40%), Gaps = 14/129 (10%) Query 32 PEAAAAAIQEA----TKKAPKALGKRPASSAKGECGAPATTSFRKR--------PRKQGR 79 P AA A+ +E TKK + G R S+ +C P TS R+R P QG Sbjct 659 PSAAVASFEEILLSFTKKGQRRDGSRDPDSSFRDCSTPPATSSRRRQNGALPGPPMWQGD 718 Query 80 LRQEKQQPEQQPPRADGVHRQEDEHGNKKRRRQQQQQHQVHQDRNQTTDMGKGEGAASDS 139 ++++ E + GV R G + R+ D + D+ + E AS Sbjct 719 FVRQRENSESR--VHHGVSRTSSMSGKRGTHRRGPDDTSTSHDWRDSGDVRQNETVASRG 776 Query 140 LGQSEKTET 148 L + E + + Sbjct 777 LVKREASNS 785 Lambda K H 0.307 0.123 0.342 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 6623499460 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40