bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_1919_orf1 Length=183 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_059550 hydroxymethyldihydropterin pyrophosphokinase... 84.7 1e-16 ath:AT1G69190 2-amino-4-hydroxy-6-hydroxymethyldihydropteridin... 37.7 0.023 ath:AT4G30000 dihydropterin pyrophosphokinase, putative / dihy... 36.2 0.072 eco:b0142 folK, ECK0141, JW0138; 2-amino-4-hydroxy-6-hydroxyme... 33.9 0.29 pfa:PF08_0095 DHPS, PPPK; dihydropteroate synthetase (EC:2.5.1... 33.1 0.47 tpv:TP01_0264 glutathione synthetase; K01920 glutathione synth... 32.0 1.3 mmu:53601 Pcdh12, Pcdh14, VE-cad-2; protocadherin 12 30.4 > tgo:TGME49_059550 hydroxymethyldihydropterin pyrophosphokinase-dihydropteroate synthase (EC:2.7.6.3 2.5.1.15); K00796 dihydropteroate synthase [EC:2.5.1.15]; K00950 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3] Length=748 Score = 84.7 bits (208), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 53/159 (33%), Positives = 87/159 (54%), Gaps = 9/159 (5%) Query 19 QPGSGGVILFCVHTATMFHLTSPRTSLQWFYKRCFSFVNGRSYSVRRFVRCVTTASSGES 78 +P GG I C + + F ++ F+ R F G + F++ + G+ Sbjct 38 RPLPGGAIAHCASSRS-FSFGLLQSKFSPFFTR---FHQGTMTANSHFLQKMREEDPGK- 92 Query 79 TRPKRPVAYISMGTNLGGERRLSILESALSSIRREVGSLDACSCLYESLPGYDVDHRSRD 138 + AYI++G+NL G+ RL I+E A+S + R +G + SCLYE++P +DV + Sbjct 93 ---EYATAYIALGSNLQGDARLGIIEEAISELGRCLGPILGTSCLYETVPAFDVCPKGV- 148 Query 139 EHDMSIPLHLNAVVRVETDSSDPQVILKILQRIEANHGR 177 HD+ P +LNAVV++ T +DP +L+IL+ +EA GR Sbjct 149 VHDVFHPFYLNAVVKLRTPITDPWYVLEILKNLEAKTGR 187 > ath:AT1G69190 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase/ dihydropteroate synthase; K13941 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15] Length=484 Score = 37.7 bits (86), Expect = 0.023, Method: Compositional matrix adjust. Identities = 28/94 (29%), Positives = 47/94 (50%), Gaps = 13/94 (13%) Query 88 ISMGTNLGGERRLSILESALSSIRREVGSLDACSCLYESLPGYDVDHRSRDEHDMSIPLH 147 I++G+N+G R++ + AL ++ S+ SCLYE+ P + D P Sbjct 16 IALGSNVGN--RMNNFKEALRLMKDYGISVTRHSCLYETEPVHVTDQ----------PRF 63 Query 148 LNAVVRVETDSSDPQVILKILQRIEANHGRDRSA 181 LNA +R T P +L +L++IE GR+ + Sbjct 64 LNAAIRGVTKLK-PHELLNVLKKIEKEMGREENG 96 > ath:AT4G30000 dihydropterin pyrophosphokinase, putative / dihydropteroate synthase, putative / DHPS, putative; K13941 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15] Length=554 Score = 36.2 bits (82), Expect = 0.072, Method: Compositional matrix adjust. Identities = 29/90 (32%), Positives = 44/90 (48%), Gaps = 13/90 (14%) Query 88 ISMGTNLGGERRLSILESALSSIRREVGSLDACSCLYESLPGYDVDHRSRDEHDMSIPLH 147 I++G+N+G R++ AL ++R + SCLYE+ P + D P Sbjct 91 IALGSNIGN--RMNNFREALRLMKRGGICVTRHSCLYETAPVHVTDQ----------PRF 138 Query 148 LNAVVRVETDSSDPQVILKILQRIEANHGR 177 LNA VR T P +L +L+ IE + GR Sbjct 139 LNAAVRGVTKLG-PHELLSVLKTIERDMGR 167 > eco:b0142 folK, ECK0141, JW0138; 2-amino-4-hydroxy-6-hydroxymethyldihyropteridine pyrophosphokinase (EC:2.7.6.3); K00950 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3] Length=159 Score = 33.9 bits (76), Expect = 0.29, Method: Compositional matrix adjust. Identities = 33/98 (33%), Positives = 46/98 (46%), Gaps = 14/98 (14%) Query 85 VAYISMGTNLGGERRLSILESALSSIRREVGS-LDACSCLYESLPGYDVDHRSRDEHDMS 143 VAYI++G+NL L + +AL ++ S + S Y + P D Sbjct 3 VAYIAIGSNLASP--LEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQ--------- 51 Query 144 IPLHLNAVVRVETDSSDPQVILKILQRIEANHGRDRSA 181 P +LNA V +ET S P+ +L QRIE GR R A Sbjct 52 -PDYLNAAVALET-SLAPEELLNHTQRIELQQGRVRKA 87 > pfa:PF08_0095 DHPS, PPPK; dihydropteroate synthetase (EC:2.5.1.15); K00796 dihydropteroate synthase [EC:2.5.1.15]; K00950 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3] Length=706 Score = 33.1 bits (74), Expect = 0.47, Method: Composition-based stats. Identities = 21/57 (36%), Positives = 34/57 (59%), Gaps = 5/57 (8%) Query 78 STRPKRPVAYISMGTNLGGERR--LSILESALSSIRREVGSLDACSCLYESLPGYDV 132 S K +A +++GTN +RR + ILE+AL + + +G + S LYE++P Y V Sbjct 10 SEENKTNIAVLNLGTN---DRRNAVLILETALHLVEKYLGKIINTSYLYETVPEYIV 63 > tpv:TP01_0264 glutathione synthetase; K01920 glutathione synthase [EC:6.3.2.3] Length=629 Score = 32.0 bits (71), Expect = 1.3, Method: Composition-based stats. Identities = 23/71 (32%), Positives = 31/71 (43%), Gaps = 6/71 (8%) Query 28 FCVHTATMFHLTSPRTSLQWFYKRCFSFVNGRSYSVRRFVRCVTTASSGESTRPKRPVAY 87 + VH T+ +PR +QW KR F V Y+ V+ + A S P R V Sbjct 328 YGVHVKTV----TPRQMIQWMKKRIFLLVRDWEYNSDGTVKLLKYADSTVKLHPGRLV-- 381 Query 88 ISMGTNLGGER 98 I MG+ G R Sbjct 382 IIMGSKPGLNR 392 > mmu:53601 Pcdh12, Pcdh14, VE-cad-2; protocadherin 12 Length=1180 Score = 30.4 bits (67), Expect = 3.9, Method: Compositional matrix adjust. Identities = 14/43 (32%), Positives = 26/43 (60%), Gaps = 1/43 (2%) Query 124 YESLPGYDVDHRSRDEHDMSIPLHLNAVVRV-ETDSSDPQVIL 165 YE P Y+VD ++RD SIP H +++V + + + P +++ Sbjct 312 YEKNPAYEVDVQARDLGPNSIPGHCKVLIKVLDVNDNAPSILI 354 Lambda K H 0.322 0.134 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 4976880524 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40