bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_1924_orf1 Length=102 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_112250 DNA-directed RNA polymerase III subunit, put... 71.2 7e-13 pfa:PFB0290c transcription factor, putative; K03019 DNA-direct... 51.2 8e-07 cpv:cgd7_505 hypothetical protein 45.4 4e-05 xla:399046 polr3k, MGC68582; polymerase (RNA) III (DNA directe... 43.1 2e-04 dre:436826 polr3k, zgc:92774; polymerase (RNA) III (DNA direct... 42.7 3e-04 hsa:51728 POLR3K, C11, C11-RNP3, RPC10, RPC11, RPC12.5, hRPC11... 40.0 0.002 ath:AT1G01210 DNA-directed RNA polymerase III family protein; ... 40.0 0.002 ath:AT4G07950 DNA-directed RNA polymerase III family protein; ... 39.7 0.002 mmu:67005 Polr3k, 12.3kDa, 1500004O14Rik, AI196849, AU014893, ... 39.3 0.003 tgo:TGME49_002690 DNA-directed RNA polymerase II subunit, puta... 38.9 0.004 sce:YDR045C RPC11; C11; K03019 DNA-directed RNA polymerase III... 33.1 0.24 > tgo:TGME49_112250 DNA-directed RNA polymerase III subunit, putative ; K03019 DNA-directed RNA polymerase III subunit RPC10 Length=106 Score = 71.2 bits (173), Expect = 7e-13, Method: Compositional matrix adjust. Identities = 27/41 (65%), Positives = 37/41 (90%), Gaps = 0/41 (0%) Query 62 MALFCPTCHNMLLLRRDAEMEFYCRTCPYIYAIKKKVARKI 102 MALFCPTCHNMLL+R++ M+F+CRTCPY++ IK+K+ RK+ Sbjct 1 MALFCPTCHNMLLVRQEVTMQFHCRTCPYVFNIKEKLTRKM 41 > pfa:PFB0290c transcription factor, putative; K03019 DNA-directed RNA polymerase III subunit RPC10 Length=106 Score = 51.2 bits (121), Expect = 8e-07, Method: Compositional matrix adjust. Identities = 19/40 (47%), Positives = 27/40 (67%), Gaps = 0/40 (0%) Query 62 MALFCPTCHNMLLLRRDAEMEFYCRTCPYIYAIKKKVARK 101 MA FCP CHN++L+ + + FYC++C Y Y IK K+ K Sbjct 1 MAFFCPNCHNIVLVHIEKGVYFYCKSCNYKYKIKNKIYNK 40 > cpv:cgd7_505 hypothetical protein Length=108 Score = 45.4 bits (106), Expect = 4e-05, Method: Compositional matrix adjust. Identities = 19/40 (47%), Positives = 27/40 (67%), Gaps = 1/40 (2%) Query 62 MALFCPTCHNMLLLRRDAE-MEFYCRTCPYIYAIKKKVAR 100 M FC CHN+LLL+ E M FYC TCPY++ I ++++ Sbjct 1 MVQFCIHCHNILLLKEHEERMAFYCPTCPYVFKIVSQISK 40 > xla:399046 polr3k, MGC68582; polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa; K03019 DNA-directed RNA polymerase III subunit RPC10 Length=108 Score = 43.1 bits (100), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 18/41 (43%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Query 62 MALFCPTCHNMLLLRRDAE-MEFYCRTCPYIYAIKKKVARK 101 M LFCPTC N+L++ + F C TCPY++ I +KV + Sbjct 1 MLLFCPTCGNVLIVEEGQKCYRFACNTCPYVHNINRKVTSR 41 > dre:436826 polr3k, zgc:92774; polymerase (RNA) III (DNA directed) polypeptide K; K03019 DNA-directed RNA polymerase III subunit RPC10 Length=108 Score = 42.7 bits (99), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Query 62 MALFCPTCHNMLLLRRDAE-MEFYCRTCPYIYAIKKKVARK 101 M LFCPTC N+L++ F C TCPY++ I +KV + Sbjct 1 MLLFCPTCGNVLIVEEGQRCFRFACNTCPYVHNITRKVNNR 41 > hsa:51728 POLR3K, C11, C11-RNP3, RPC10, RPC11, RPC12.5, hRPC11; polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa; K03019 DNA-directed RNA polymerase III subunit RPC10 Length=108 Score = 40.0 bits (92), Expect = 0.002, Method: Compositional matrix adjust. Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Query 62 MALFCPTCHNMLLLRRDAE-MEFYCRTCPYIYAIKKKVARK 101 M LFCP C N L++ F C TCPY++ I +KV + Sbjct 1 MLLFCPGCGNGLIVEEGQRCHRFSCNTCPYVHNITRKVTNR 41 > ath:AT1G01210 DNA-directed RNA polymerase III family protein; K03019 DNA-directed RNA polymerase III subunit RPC10 Length=106 Score = 40.0 bits (92), Expect = 0.002, Method: Compositional matrix adjust. Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 0/37 (0%) Query 65 FCPTCHNMLLLRRDAEMEFYCRTCPYIYAIKKKVARK 101 FCPTC N+L F+C TCPY+ I+++V K Sbjct 3 FCPTCGNLLRYEGGGNSRFFCSTCPYVAYIQRQVEIK 39 > ath:AT4G07950 DNA-directed RNA polymerase III family protein; K03019 DNA-directed RNA polymerase III subunit RPC10 Length=106 Score = 39.7 bits (91), Expect = 0.002, Method: Compositional matrix adjust. Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 0/37 (0%) Query 65 FCPTCHNMLLLRRDAEMEFYCRTCPYIYAIKKKVARK 101 FCPTC N+L F+C TCPY+ I+++V K Sbjct 3 FCPTCGNLLRYEGGGSSRFFCSTCPYVANIERRVEIK 39 > mmu:67005 Polr3k, 12.3kDa, 1500004O14Rik, AI196849, AU014893, C11, RPC10, RPC11; polymerase (RNA) III (DNA directed) polypeptide K; K03019 DNA-directed RNA polymerase III subunit RPC10 Length=108 Score = 39.3 bits (90), Expect = 0.003, Method: Compositional matrix adjust. Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Query 62 MALFCPTCHNMLLLRRDAE-MEFYCRTCPYIYAIKKKVARK 101 M LFCP C N L++ F C TCPY++ I +KV + Sbjct 1 MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNR 41 > tgo:TGME49_002690 DNA-directed RNA polymerase II subunit, putative (EC:2.7.7.6 3.2.1.3); K03017 DNA-directed RNA polymerase II subunit RPB9 Length=335 Score = 38.9 bits (89), Expect = 0.004, Method: Composition-based stats. Identities = 19/43 (44%), Positives = 24/43 (55%), Gaps = 4/43 (9%) Query 64 LFCPTCHNMLLLRRDAE---MEFYCRTCPYI-YAIKKKVARKI 102 +FCP C+NML R D E ++F CR C Y Y K A+ I Sbjct 7 MFCPECNNMLYPREDKEKRQLQFLCRQCDYSRYPKKTDTAQHI 49 > sce:YDR045C RPC11; C11; K03019 DNA-directed RNA polymerase III subunit RPC10 Length=110 Score = 33.1 bits (74), Expect = 0.24, Method: Compositional matrix adjust. Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 11/50 (22%) Query 62 MALFCPTCHNMLLLRRDAEMEFY---CRTCPYIYAI-------KKKVARK 101 M FCP+C+NMLL+ + Y CR+CPY + I +KK+ RK Sbjct 1 MLSFCPSCNNMLLITS-GDSGVYTLACRSCPYEFPIEGIEIYDRKKLPRK 49 Lambda K H 0.325 0.130 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2031832220 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40