bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_1961_orf1 Length=169 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_080380 non-transmembrane antigen (EC:3.2.1.143); K0... 60.8 2e-09 mmu:226182 Taf5, 6330528C20Rik, AV117817; TAF5 RNA polymerase ... 34.3 0.19 cpv:cgd6_2600 hypothetical protein 29.3 6.2 tgo:TGME49_057430 hypothetical protein 29.3 6.4 > tgo:TGME49_080380 non-transmembrane antigen (EC:3.2.1.143); K07759 poly(ADP-ribose) glycohydrolase [EC:3.2.1.143] Length=553 Score = 60.8 bits (146), Expect = 2e-09, Method: Composition-based stats. Identities = 37/112 (33%), Positives = 57/112 (50%), Gaps = 3/112 (2%) Query 60 AILLPQNPQGWQQVQQILAEVEAGKVPKTAGEYKQLFTSILTAAGNWRVDKPLRI---GP 116 AIL + W + + IL V +G P + L +L +GN R +K RI G Sbjct 47 AILRTPVEEDWGKTKYILNFVASGFGPADPQQLASLQKRLLKLSGNIRTEKNKRILQRGL 106 Query 117 LTHHLATHKNLSKSLLPFLASLARRLPDFFPSGIRHLGRDNPAVHLRRIEVL 168 L + LPF+A+L R+ + FPSG++++ +NP VHLR+I+V Sbjct 107 LNYLEENPGKFFSHDLPFMATLVMRIDELFPSGLQYITPENPQVHLRKIQVF 158 > mmu:226182 Taf5, 6330528C20Rik, AV117817; TAF5 RNA polymerase II, TATA box binding protein (TBP)-associated factor; K03130 transcription initiation factor TFIID subunit 5 Length=801 Score = 34.3 bits (77), Expect = 0.19, Method: Compositional matrix adjust. Identities = 27/72 (37%), Positives = 36/72 (50%), Gaps = 4/72 (5%) Query 2 GAAAAVAAALLLLLFVSPPGFAAAAPPGDDDGAVAGTSAAAAAAAA----AAAAAQQQQG 57 GA A A+ALL + S PG AA PPG + S +A+ AA A+ A + Q Sbjct 139 GAGAEAASALLSRVTASVPGSAAPEPPGTGASVTSVFSGSASGPAAPGKVASVAVEDQPD 198 Query 58 LRAILLPQNPQG 69 + A+L N QG Sbjct 199 VSAVLSAYNQQG 210 > cpv:cgd6_2600 hypothetical protein Length=692 Score = 29.3 bits (64), Expect = 6.2, Method: Composition-based stats. Identities = 21/73 (28%), Positives = 32/73 (43%), Gaps = 4/73 (5%) Query 37 GTSAAAAAAAAAAAAAQQQQGLRAILLPQNPQGWQQVQQILA--EVEAGKVPKTAGEYKQ 94 +S + A A ++ G+ + Q PQGW+ V E E KVP A E + Sbjct 300 ASSQSTATPQPQVRGAVRKSGVPGVYWSQKPQGWRVVYYTGKDREFEYFKVPANASE--E 357 Query 95 LFTSILTAAGNWR 107 + + IL A +R Sbjct 358 IISEILEVAKRFR 370 > tgo:TGME49_057430 hypothetical protein Length=2250 Score = 29.3 bits (64), Expect = 6.4, Method: Compositional matrix adjust. Identities = 20/74 (27%), Positives = 32/74 (43%), Gaps = 13/74 (17%) Query 21 GFAAAAPPGDDDGAVAGTSAAAAAAAAAAAAAQQQQGLRAILLPQNPQGWQQVQQILAEV 80 G AAAP GD DG +G+S A+ A++ A W +V +A Sbjct 898 GVCAAAPEGDSDGRGSGSSTYRRASCASSVGAASSD-------------WAEVPGPVAST 944 Query 81 EAGKVPKTAGEYKQ 94 A ++P T + ++ Sbjct 945 RASRLPATQAQARR 958 Lambda K H 0.319 0.132 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 4222647260 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40