bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_2128_orf1 Length=91 Score E Sequences producing significant alignments: (Bits) Value tpv:TP03_0432 replication factor C subunit 4; K10755 replicati... 84.0 1e-16 tgo:TGME49_010960 replication factor C subunit, putative (EC:2... 78.6 5e-15 cpv:cgd3_1450 replication factor C like AAA+ ATpase ; K10755 r... 65.9 3e-11 bbo:BBOV_IV002210 21.m03053; replication factor C subunit 4; K... 60.8 1e-09 pfa:PFL2005w replication factor C subunit 4; K10755 replicatio... 52.8 3e-07 xla:431883 rfc2, MGC81391, rfc40; replication factor C (activa... 50.4 1e-06 hsa:5982 RFC2, A1, MGC3665, RFC40; replication factor C (activ... 49.7 3e-06 dre:503748 rfc2, zgc:110810; replication factor C (activator 1... 48.9 4e-06 mmu:19718 Rfc2, 2610008M13Rik, 40kDa, AI326953, MGC117486, Rec... 48.5 5e-06 cel:F58F6.4 rfc-2; RFC (DNA replication factor) family member ... 47.8 7e-06 ath:AT1G63160 replication factor C 40 kDa, putative; K10755 re... 47.4 1e-05 sce:YOL094C RFC4; Rfc4p; K10755 replication factor C subunit 2/4 43.9 ath:AT5G53540 MSP1 protein, putative / intramitochondrial sort... 28.5 5.6 > tpv:TP03_0432 replication factor C subunit 4; K10755 replication factor C subunit 2/4 Length=324 Score = 84.0 bits (206), Expect = 1e-16, Method: Composition-based stats. Identities = 37/82 (45%), Positives = 57/82 (69%), Gaps = 2/82 (2%) Query 7 WYGAQSVARVILSLGYTPLDVVTTFRGVLRRADSELQEHLLLEFLGIVGMTHMTMAGGLS 66 W A +L LG++P+D++ T R VL+ D+ EH+LLE++ V ++HMTM GLS Sbjct 245 WRQAHEKVDQLLELGHSPVDILVTMRNVLKTMDAP--EHVLLEYIKSVALSHMTMVNGLS 302 Query 67 TELQMEKMLAQLCKVAISFRPS 88 T+LQ+EK+LA LCK+A++ R + Sbjct 303 TQLQLEKLLANLCKIALALRTT 324 > tgo:TGME49_010960 replication factor C subunit, putative (EC:2.7.7.7); K10755 replication factor C subunit 2/4 Length=336 Score = 78.6 bits (192), Expect = 5e-15, Method: Compositional matrix adjust. Identities = 36/66 (54%), Positives = 47/66 (71%), Gaps = 0/66 (0%) Query 7 WYGAQSVARVILSLGYTPLDVVTTFRGVLRRADSELQEHLLLEFLGIVGMTHMTMAGGLS 66 W A +A +L GYTP+DVV T R VL R ++E +EH+LLE+L VG+ HMTM+ GLS Sbjct 271 WREAHDIAAELLRRGYTPMDVVLTTRSVLSRFENECKEHILLEYLKYVGLAHMTMSAGLS 330 Query 67 TELQME 72 T LQ+E Sbjct 331 TPLQLE 336 > cpv:cgd3_1450 replication factor C like AAA+ ATpase ; K10755 replication factor C subunit 2/4 Length=339 Score = 65.9 bits (159), Expect = 3e-11, Method: Composition-based stats. Identities = 32/76 (42%), Positives = 46/76 (60%), Gaps = 2/76 (2%) Query 7 WYGAQSVARVILSLGYTPLDVVTTFRGVLRRADSELQEHLLLEFLGIVGMTHMTMAGGLS 66 W A S+ + GY+PLD+V T R VL+R +L E +LE+L VG H M G + Sbjct 255 WRLAHSIVEELFIGGYSPLDIVITMRNVLKR--YQLPERAILEYLKEVGRCHFVMLDGCA 312 Query 67 TELQMEKMLAQLCKVA 82 T LQ++K+L QLC ++ Sbjct 313 TPLQLDKLLGQLCMIS 328 > bbo:BBOV_IV002210 21.m03053; replication factor C subunit 4; K10755 replication factor C subunit 2/4 Length=306 Score = 60.8 bits (146), Expect = 1e-09, Method: Composition-based stats. Identities = 28/66 (42%), Positives = 42/66 (63%), Gaps = 2/66 (3%) Query 7 WYGAQSVARVILSLGYTPLDVVTTFRGVLRRADSELQEHLLLEFLGIVGMTHMTMAGGLS 66 W A A +L+LG++P D++ T R VL+ + EH+L EFL + ++HMTM GLS Sbjct 243 WRPAHEKAEDLLALGHSPFDILMTVRSVLKTLKAP--EHILCEFLKTISLSHMTMISGLS 300 Query 67 TELQME 72 + LQ+E Sbjct 301 SPLQLE 306 > pfa:PFL2005w replication factor C subunit 4; K10755 replication factor C subunit 2/4 Length=336 Score = 52.8 bits (125), Expect = 3e-07, Method: Composition-based stats. Identities = 30/80 (37%), Positives = 44/80 (55%), Gaps = 1/80 (1%) Query 7 WYGAQSVARVILSLGYTPLDVVTTFRGVLRRADSELQEHLLLEFLGIVGMTHMTMAGGLS 66 W A +A ++ G+TP D+ T VLRR + E + +EFL I M TMA GL+ Sbjct 255 WKKAHDIAYSMIKEGHTPYDISLTSSNVLRRFNIG-SEVIQIEFLKIGAMACNTMATGLT 313 Query 67 TELQMEKMLAQLCKVAISFR 86 + +Q++K+LA C A R Sbjct 314 SVIQLDKLLADWCMAAKILR 333 > xla:431883 rfc2, MGC81391, rfc40; replication factor C (activator 1) 2, 40kDa; K10755 replication factor C subunit 2/4 Length=348 Score = 50.4 bits (119), Expect = 1e-06, Method: Composition-based stats. Identities = 27/66 (40%), Positives = 43/66 (65%), Gaps = 3/66 (4%) Query 20 LGYTPLDVVTTFRGVLRRADSELQEHLLLEFLGIVGMTHMTMAGGLSTELQMEKMLAQLC 79 LGY+P D++ V + ++ E+L LEF+ +G THM +A G+++ LQM +LA+LC Sbjct 283 LGYSPEDIIGNIFRVCKTF--QMPEYLKLEFIKEIGYTHMKIAEGVNSLLQMAGLLARLC 340 Query 80 -KVAIS 84 K A+S Sbjct 341 QKTAVS 346 > hsa:5982 RFC2, A1, MGC3665, RFC40; replication factor C (activator 1) 2, 40kDa; K10755 replication factor C subunit 2/4 Length=320 Score = 49.7 bits (117), Expect = 3e-06, Method: Composition-based stats. Identities = 24/61 (39%), Positives = 40/61 (65%), Gaps = 2/61 (3%) Query 20 LGYTPLDVVTTFRGVLRRADSELQEHLLLEFLGIVGMTHMTMAGGLSTELQMEKMLAQLC 79 LGY+P D++ V + ++ E+L LEF+ +G THM +A G+++ LQM +LA+LC Sbjct 254 LGYSPEDIIGNIFRVCKTF--QMAEYLKLEFIKEIGYTHMKIAEGVNSLLQMAGLLARLC 311 Query 80 K 80 + Sbjct 312 Q 312 > dre:503748 rfc2, zgc:110810; replication factor C (activator 1) 2; K10755 replication factor C subunit 2/4 Length=349 Score = 48.9 bits (115), Expect = 4e-06, Method: Composition-based stats. Identities = 24/71 (33%), Positives = 43/71 (60%), Gaps = 2/71 (2%) Query 10 AQSVARVILSLGYTPLDVVTTFRGVLRRADSELQEHLLLEFLGIVGMTHMTMAGGLSTEL 69 A + + SLGY+P D++ V + ++ E+L LE++ +G THM +A G+++ L Sbjct 273 AYKIIEQLWSLGYSPEDIIGNIFRVCKTF--QMAEYLKLEYIKEIGYTHMKVAEGVNSLL 330 Query 70 QMEKMLAQLCK 80 QM +L +LC+ Sbjct 331 QMAGLLGRLCR 341 > mmu:19718 Rfc2, 2610008M13Rik, 40kDa, AI326953, MGC117486, Recc2; replication factor C (activator 1) 2; K10755 replication factor C subunit 2/4 Length=349 Score = 48.5 bits (114), Expect = 5e-06, Method: Composition-based stats. Identities = 25/61 (40%), Positives = 39/61 (63%), Gaps = 2/61 (3%) Query 20 LGYTPLDVVTTFRGVLRRADSELQEHLLLEFLGIVGMTHMTMAGGLSTELQMEKMLAQLC 79 LGY+P DV+ V + + E+L LEF+ +G THM +A G+++ LQM +LA+LC Sbjct 283 LGYSPEDVIGNIFRVCKTF--PMAEYLKLEFIKEIGYTHMKVAEGVNSLLQMAGLLARLC 340 Query 80 K 80 + Sbjct 341 Q 341 > cel:F58F6.4 rfc-2; RFC (DNA replication factor) family member (rfc-2); K10755 replication factor C subunit 2/4 Length=334 Score = 47.8 bits (112), Expect = 7e-06, Method: Composition-based stats. Identities = 22/79 (27%), Positives = 46/79 (58%), Gaps = 2/79 (2%) Query 5 RVWYGAQSVARVILSLGYTPLDVVTTFRGVLRRAD--SELQEHLLLEFLGIVGMTHMTMA 62 R ++ A + LG++ D+V+T V++ + + E L +E++ + M HM + Sbjct 247 RKFFEASKIIHEFHRLGFSSDDIVSTLFRVVKTVELSKNVSEQLRMEYIRQIAMCHMRIV 306 Query 63 GGLSTELQMEKMLAQLCKV 81 GL+++LQ+ +++A LC+V Sbjct 307 QGLTSKLQLSRLIADLCRV 325 > ath:AT1G63160 replication factor C 40 kDa, putative; K10755 replication factor C subunit 2/4 Length=333 Score = 47.4 bits (111), Expect = 1e-05, Method: Composition-based stats. Identities = 23/65 (35%), Positives = 39/65 (60%), Gaps = 2/65 (3%) Query 17 ILSLGYTPLDVVTTFRGVLRRADSELQEHLLLEFLGIVGMTHMTMAGGLSTELQMEKMLA 76 + LGY+P D++TT +++ D + E+L LEF+ G HM + G+ + LQ+ +LA Sbjct 264 LYDLGYSPTDIITTLFRIIKNYD--MAEYLKLEFMKETGFAHMRICDGVGSYLQLCGLLA 321 Query 77 QLCKV 81 +L V Sbjct 322 KLSIV 326 > sce:YOL094C RFC4; Rfc4p; K10755 replication factor C subunit 2/4 Length=323 Score = 43.9 bits (102), Expect = 1e-04, Method: Composition-based stats. Identities = 23/62 (37%), Positives = 42/62 (67%), Gaps = 3/62 (4%) Query 21 GYTPLDVVTT-FRGVLRRADSELQEHLLLEFLGIVGMTHMTMAGGLSTELQMEKMLAQLC 79 GY+ +D+VTT FR + + ++++E + LE + +G+THM + G+ T LQ+ MLA++ Sbjct 260 GYSSIDIVTTSFR--VTKNLAQVKESVRLEMIKEIGLTHMRILEGVGTYLQLASMLAKIH 317 Query 80 KV 81 K+ Sbjct 318 KL 319 > ath:AT5G53540 MSP1 protein, putative / intramitochondrial sorting protein, putative Length=403 Score = 28.5 bits (62), Expect = 5.6, Method: Composition-based stats. Identities = 25/89 (28%), Positives = 39/89 (43%), Gaps = 20/89 (22%) Query 7 WYG-AQSVARVILSLGYT--P----LDVVTTFRGVLRRADSELQEHLLLEFLGIVGMTHM 59 W+G AQ + + SL Y P +D V +F G R D+E ++ EF M Sbjct 162 WFGDAQKLVSAVFSLAYKLQPAIIFIDEVDSFLGQRRSTDNEAMSNMKTEF--------M 213 Query 60 TMAGGLSTELQMEKMLAQLCKVAISFRPS 88 + G +T+ M+ +A + RPS Sbjct 214 ALWDGFTTDQNARVMV-----LAATNRPS 237 Lambda K H 0.326 0.139 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2007827920 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40