bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_2280_orf1 Length=183 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_023410 eukaryotic translation initiation factor 4E,... 148 1e-35 cpv:cgd6_1020 translation initiation factor if-4E ; K03259 tra... 101 1e-21 pfa:PFC0635c translation initiation factor E4, putative; K0325... 91.7 1e-18 bbo:BBOV_III011150 17.m10646; translation initiation factor E4... 89.4 7e-18 tpv:TP02_0735 translation initiation factor E4; K03259 transla... 89.0 8e-18 dre:550549 eif4e1c, eif4E-1C, fb57e09, wu:fb57e09, zgc:110154;... 50.1 4e-06 xla:734669 hypothetical protein MGC116437; K03259 translation ... 45.1 1e-04 mmu:26987 Eif4e2, 2700069E09Rik, AI036339, AV129531, D0H0S6743... 45.1 1e-04 hsa:9470 EIF4E2, 4E-LP, 4EHP, EIF4EL3, IF4e; eukaryotic transl... 44.7 2e-04 dre:393732 eif4e2rs1, MGC73242, zgc:73242; eukaryotic translat... 44.3 2e-04 dre:541523 eif4e2, MGC158544, id:ibd1007, zgc:110542, zgc:1585... 43.9 3e-04 dre:30738 eif4e1b, Z4ES, eif4e, zeIF4E; eukaryotic translation... 42.4 0.001 hsa:1977 EIF4E, CBP, EIF4E1, EIF4EL1, EIF4F, MGC111573; eukary... 41.6 0.002 dre:100332201 eukaryotic translation initiation factor 4E-1A-like 41.2 0.002 mmu:13684 Eif4e, EG668879, Eif4e-ps, If4e, MGC103177, eIF-4E; ... 41.2 0.002 dre:493617 zgc:101581 41.2 0.002 xla:399255 eif4e, MGC84530; eIF-4E protein; K03259 translation... 41.2 0.002 dre:79380 eif4e, eif4e-1, eif4e1a, zgc:86680; eukaryotic trans... 41.2 0.002 xla:734259 eif4e, MGC85107, eIF-4E, eif4e1; eukaryotic transla... 41.2 0.002 sce:YOL139C CDC33, TIF45; Cdc33p; K03259 translation initiatio... 40.8 0.003 xla:734605 eif4e2, MGC115622; eukaryotic translation initiatio... 40.4 0.004 mmu:244958 Mrap2, BB633055; melanocortin 2 receptor accessory ... 38.5 0.013 cel:B0348.6 ife-3; Initiation Factor 4E (eIF4E) family member ... 37.7 0.024 hsa:112609 MRAP2, C6orf117, RP11-51G5.2, bA51G5.2; melanocorti... 37.4 0.029 mmu:218268 Eif4e1b, AA473955, Eif4eloo, Gm273; eukaryotic tran... 37.0 0.037 hsa:253314 EIF4E1B, FLJ36951; eukaryotic translation initiatio... 37.0 0.040 ath:AT5G18110 NCBP; NCBP (NOVEL CAP-BINDING PROTEIN); RNA bind... 35.8 0.075 ath:AT4G18040 EIF4E; EIF4E (EUKARYOTIC TRANSLATION INITATION F... 34.7 0.17 mmu:66892 Eif4e3, 1300018P11Rik, AI451927, eIF4E-3; eukaryotic... 34.7 0.21 dre:447850 eif4e3, wu:fc31f11, wu:fd15f11, zgc:92189; eukaryot... 31.2 1.9 ath:AT5G35620 LSP1; LSP1 (LOSS OF SUSCEPTIBILITY TO POTYVIRUS ... 31.2 2.2 tgo:TGME49_010780 ubiquitin carboxyl-terminal hydrolase, putat... 30.8 2.5 xla:414635 eif4e3-b, MGC81298, eif4e3; eukaryotic translation ... 30.8 2.8 cel:F53A2.6 ife-1; Initiation Factor 4E (eIF4E) family member ... 30.0 4.6 cel:Y57A10A.30 ife-5; Initiation Factor 4E (eIF4E) family memb... 29.3 6.9 xla:443785 eif4e3-a, MGC81435; eukaryotic translation initiati... 29.3 7.7 > tgo:TGME49_023410 eukaryotic translation initiation factor 4E, putative ; K03259 translation initiation factor 4E Length=198 Score = 148 bits (373), Expect = 1e-35, Method: Compositional matrix adjust. Identities = 67/110 (60%), Positives = 88/110 (80%), Gaps = 4/110 (3%) Query 74 STKYLSFNPSVADAVNLDECITEERPADAPMPLQHRWHVWEQIQREAAAADRAADYSQNT 133 + K+LSFN + +AV+L + + EE D P+PL++ WHVWEQ+Q++ DR+ +YS NT Sbjct 2 AAKFLSFNQELNEAVDLKDWVKEEPVPDEPLPLRYVWHVWEQVQQD----DRSKEYSDNT 57 Query 134 RDLASFDTVQTFWQLWAHIPQPSELLGHKRMIRQDSSGKSHVVDALMIFK 183 RDLA+FDTVQ FWQLW+ IPQPSELL HKRM+RQD +G+SHVVDA+MIFK Sbjct 58 RDLAAFDTVQKFWQLWSFIPQPSELLDHKRMVRQDKNGRSHVVDAVMIFK 107 > cpv:cgd6_1020 translation initiation factor if-4E ; K03259 translation initiation factor 4E Length=240 Score = 101 bits (252), Expect = 1e-21, Method: Compositional matrix adjust. Identities = 54/113 (47%), Positives = 70/113 (61%), Gaps = 7/113 (6%) Query 75 TKYLSFNPSVADAVNLDECITE-ERPADA---PMPLQHRWHVWEQIQREAAAADRAADYS 130 +KYLSFN S+ + L +E + P D P+PL H W VWEQ+ E + DYS Sbjct 8 SKYLSFNESIEPNLTLPTACSEVDLPEDLISRPLPLSHEWIVWEQLNVETR---KDLDYS 64 Query 131 QNTRDLASFDTVQTFWQLWAHIPQPSELLGHKRMIRQDSSGKSHVVDALMIFK 183 T+ +A F +VQ FW LW +IPQPSELL KRMIR+ S G VVDA+++FK Sbjct 65 NATKPVARFSSVQQFWWLWHNIPQPSELLKGKRMIRESSDGSKSVVDAVILFK 117 > pfa:PFC0635c translation initiation factor E4, putative; K03259 translation initiation factor 4E Length=227 Score = 91.7 bits (226), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 45/109 (41%), Positives = 65/109 (59%), Gaps = 3/109 (2%) Query 76 KYLSFNPSVADAVNLDECITEER-PADAPMPLQHRWHVWEQIQREAAAADRAADYSQNTR 134 KYL+FN + DA++L E + + P+ LQ+ W +WEQ+ ++ +Y TR Sbjct 2 KYLTFNKNNRDAIDLSEKLEATKIDLSNPLLLQYNWVIWEQVSDNKIK--QSNNYKDYTR 59 Query 135 DLASFDTVQTFWQLWAHIPQPSELLGHKRMIRQDSSGKSHVVDALMIFK 183 LA F++VQ FWQLW +PQPS+LL + M R G +VDALMIF+ Sbjct 60 PLAKFNSVQKFWQLWNRLPQPSDLLAQRSMTRFSEDGIFRIVDALMIFR 108 > bbo:BBOV_III011150 17.m10646; translation initiation factor E4; K03259 translation initiation factor 4E Length=242 Score = 89.4 bits (220), Expect = 7e-18, Method: Compositional matrix adjust. Identities = 44/107 (41%), Positives = 66/107 (61%), Gaps = 2/107 (1%) Query 78 LSFNPSVADAVNLDECI-TEERPADAPMPLQHRWHVWEQIQREAAAADRAADYSQNTRDL 136 L+FN D + E T PMPL+++W +WEQI + + + DY T+ L Sbjct 22 LTFNKKSEDFKRVAELFETSNVDISTPMPLRNKWVIWEQIVK-GQDSRNSNDYKCYTKPL 80 Query 137 ASFDTVQTFWQLWAHIPQPSELLGHKRMIRQDSSGKSHVVDALMIFK 183 SFD+VQ+FW LW +IPQPSEL +R+ R+ + G +H+VDA+M+F+ Sbjct 81 VSFDSVQSFWNLWFNIPQPSELSTTQRLSRECTDGSNHIVDAIMVFR 127 > tpv:TP02_0735 translation initiation factor E4; K03259 translation initiation factor 4E Length=221 Score = 89.0 bits (219), Expect = 8e-18, Method: Compositional matrix adjust. Identities = 44/104 (42%), Positives = 62/104 (59%), Gaps = 3/104 (2%) Query 78 LSFNPSVADAVNLDECITEER-PADAPMPLQHRWHVWEQIQREAAAADRAADYSQNTRDL 136 L+FN + D L E D P+ L+++W +WEQI + + DY ++T+ L Sbjct 18 LTFNKNTEDHAKLSELFESTTINLDTPLSLKNKWVIWEQIVKMPEHSQN--DYKEHTKPL 75 Query 137 ASFDTVQTFWQLWAHIPQPSELLGHKRMIRQDSSGKSHVVDALM 180 SFD+VQ FW LW +IPQPSEL +KR+ R+ S G H VDA+M Sbjct 76 VSFDSVQAFWNLWFNIPQPSELATNKRLARECSDGSEHFVDAIM 119 > dre:550549 eif4e1c, eif4E-1C, fb57e09, wu:fb57e09, zgc:110154; eukaryotic translation initiation factor 4E family member 1c; K03259 translation initiation factor 4E Length=213 Score = 50.1 bits (118), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 19/77 (24%) Query 95 TEERPADAPM-------------PLQHRWHVWEQIQREAAAADRAADYSQNTRDLASFDT 141 TEE +D+P PLQ+RW +W D++ +++N R ++ FDT Sbjct 11 TEEVRSDSPTAVVTTSPEQYIKHPLQNRWALW------YFKNDKSKSWTENLRLISKFDT 64 Query 142 VQTFWQLWAHIPQPSEL 158 V+ FW L+ HI QPS+L Sbjct 65 VEDFWALYNHIQQPSKL 81 > xla:734669 hypothetical protein MGC116437; K03259 translation initiation factor 4E Length=235 Score = 45.1 bits (105), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 19/63 (30%), Positives = 34/63 (53%), Gaps = 1/63 (1%) Query 99 PADAPMPLQHRWHVWEQIQREAAAADRAADYSQNTRDLASFDTVQTFWQLWAHIPQPSEL 158 P A PLQ+ + W +R + Y QN + + +F +V+ FW+ ++H+ +P +L Sbjct 50 PGPAEHPLQYNYTFWYS-RRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDL 108 Query 159 LGH 161 GH Sbjct 109 TGH 111 > mmu:26987 Eif4e2, 2700069E09Rik, AI036339, AV129531, D0H0S6743E, Eif4el3; eukaryotic translation initiation factor 4E member 2; K03259 translation initiation factor 4E Length=240 Score = 45.1 bits (105), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 19/63 (30%), Positives = 34/63 (53%), Gaps = 1/63 (1%) Query 99 PADAPMPLQHRWHVWEQIQREAAAADRAADYSQNTRDLASFDTVQTFWQLWAHIPQPSEL 158 P A PLQ+ + W +R + Y QN + + +F +V+ FW+ ++H+ +P +L Sbjct 44 PGPAEHPLQYNYTFWYS-RRTPGRPTSSQSYEQNIKQIGTFASVEQFWKFYSHMVRPGDL 102 Query 159 LGH 161 GH Sbjct 103 TGH 105 > hsa:9470 EIF4E2, 4E-LP, 4EHP, EIF4EL3, IF4e; eukaryotic translation initiation factor 4E family member 2; K03259 translation initiation factor 4E Length=245 Score = 44.7 bits (104), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 19/63 (30%), Positives = 34/63 (53%), Gaps = 1/63 (1%) Query 99 PADAPMPLQHRWHVWEQIQREAAAADRAADYSQNTRDLASFDTVQTFWQLWAHIPQPSEL 158 P A PLQ+ + W +R + Y QN + + +F +V+ FW+ ++H+ +P +L Sbjct 49 PGPAEHPLQYNYTFWYS-RRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDL 107 Query 159 LGH 161 GH Sbjct 108 TGH 110 > dre:393732 eif4e2rs1, MGC73242, zgc:73242; eukaryotic translation initiation factor 4E family member 2 related sequence 1; K03259 translation initiation factor 4E Length=228 Score = 44.3 bits (103), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 1/63 (1%) Query 99 PADAPMPLQHRWHVWEQIQREAAAADRAADYSQNTRDLASFDTVQTFWQLWAHIPQPSEL 158 PA PLQ+ + W +R + Y QN R + + +V+ FW+ ++H+ +P +L Sbjct 43 PAAGEHPLQYNYTFWYS-RRTPSRPANTQSYEQNIRQMGTVASVEQFWKFYSHLVRPGDL 101 Query 159 LGH 161 GH Sbjct 102 TGH 104 > dre:541523 eif4e2, MGC158544, id:ibd1007, zgc:110542, zgc:158544; eukaryotic translation initiation factor 4E family member 2; K03259 translation initiation factor 4E Length=236 Score = 43.9 bits (102), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 1/63 (1%) Query 99 PADAPMPLQHRWHVWEQIQREAAAADRAADYSQNTRDLASFDTVQTFWQLWAHIPQPSEL 158 P PLQ+ + W +R Y QN + + SF +V+ FW+ ++H+ +P +L Sbjct 48 PGAGEHPLQYNYTFWYS-RRTPGRPASTQSYEQNIKQIGSFASVEQFWRFYSHMIRPGDL 106 Query 159 LGH 161 GH Sbjct 107 TGH 109 > dre:30738 eif4e1b, Z4ES, eif4e, zeIF4E; eukaryotic translation initiation factor 4e 1b Length=214 Score = 42.4 bits (98), Expect = 0.001, Method: Compositional matrix adjust. Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 6/54 (11%) Query 105 PLQHRWHVWEQIQREAAAADRAADYSQNTRDLASFDTVQTFWQLWAHIPQPSEL 158 PLQ+RW +W D++ + N R + FDTV+ FW L+ +I PS+L Sbjct 35 PLQNRWGLW------FYKNDKSKMWQDNLRLITKFDTVEDFWGLYNNIQLPSKL 82 > hsa:1977 EIF4E, CBP, EIF4E1, EIF4EL1, EIF4F, MGC111573; eukaryotic translation initiation factor 4E; K03259 translation initiation factor 4E Length=237 Score = 41.6 bits (96), Expect = 0.002, Method: Compositional matrix adjust. Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 6/55 (10%) Query 105 PLQHRWHVWEQIQREAAAADRAADYSQNTRDLASFDTVQTFWQLWAHIPQPSELL 159 PLQ+RW +W D++ + N R ++ FDTV+ FW L+ HI S L+ Sbjct 58 PLQNRWALW------FFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLM 106 > dre:100332201 eukaryotic translation initiation factor 4E-1A-like Length=215 Score = 41.2 bits (95), Expect = 0.002, Method: Compositional matrix adjust. Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 6/55 (10%) Query 105 PLQHRWHVWEQIQREAAAADRAADYSQNTRDLASFDTVQTFWQLWAHIPQPSELL 159 PLQ+RW +W D++ + N R ++ FDTV+ FW L+ HI S L+ Sbjct 36 PLQNRWALW------FFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLM 84 > mmu:13684 Eif4e, EG668879, Eif4e-ps, If4e, MGC103177, eIF-4E; eukaryotic translation initiation factor 4E; K03259 translation initiation factor 4E Length=217 Score = 41.2 bits (95), Expect = 0.002, Method: Compositional matrix adjust. Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 6/55 (10%) Query 105 PLQHRWHVWEQIQREAAAADRAADYSQNTRDLASFDTVQTFWQLWAHIPQPSELL 159 PLQ+RW +W D++ + N R ++ FDTV+ FW L+ HI S L+ Sbjct 38 PLQNRWALW------FFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLM 86 > dre:493617 zgc:101581 Length=216 Score = 41.2 bits (95), Expect = 0.002, Method: Compositional matrix adjust. Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 6/55 (10%) Query 105 PLQHRWHVWEQIQREAAAADRAADYSQNTRDLASFDTVQTFWQLWAHIPQPSELL 159 PLQ+RW +W D++ + N R ++ FDTV+ FW L+ HI S L+ Sbjct 37 PLQNRWCLW------FFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLM 85 > xla:399255 eif4e, MGC84530; eIF-4E protein; K03259 translation initiation factor 4E Length=231 Score = 41.2 bits (95), Expect = 0.002, Method: Compositional matrix adjust. Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 6/55 (10%) Query 105 PLQHRWHVWEQIQREAAAADRAADYSQNTRDLASFDTVQTFWQLWAHIPQPSELL 159 PLQ+RW +W D++ + N R ++ FDTV+ FW L+ HI S L+ Sbjct 52 PLQNRWALW------FFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLM 100 > dre:79380 eif4e, eif4e-1, eif4e1a, zgc:86680; eukaryotic translation initiation factor 4e; K03259 translation initiation factor 4E Length=215 Score = 41.2 bits (95), Expect = 0.002, Method: Compositional matrix adjust. Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 6/55 (10%) Query 105 PLQHRWHVWEQIQREAAAADRAADYSQNTRDLASFDTVQTFWQLWAHIPQPSELL 159 PLQ+RW +W D++ + N R ++ FDTV+ FW L+ HI S L+ Sbjct 36 PLQNRWALW------FFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLM 84 > xla:734259 eif4e, MGC85107, eIF-4E, eif4e1; eukaryotic translation initiation factor 4E; K03259 translation initiation factor 4E Length=213 Score = 41.2 bits (95), Expect = 0.002, Method: Compositional matrix adjust. Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 6/55 (10%) Query 105 PLQHRWHVWEQIQREAAAADRAADYSQNTRDLASFDTVQTFWQLWAHIPQPSELL 159 PLQ+RW +W D++ + N R ++ FDTV+ FW L+ HI S L+ Sbjct 34 PLQNRWALW------FFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLM 82 > sce:YOL139C CDC33, TIF45; Cdc33p; K03259 translation initiation factor 4E Length=213 Score = 40.8 bits (94), Expect = 0.003, Method: Compositional matrix adjust. Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 4/58 (6%) Query 101 DAPMPLQHRWHVWEQIQREAAAADRAADYSQNTRDLASFDTVQTFWQLWAHIPQPSEL 158 D PL +W +W A D++ +S R + SF TV+ FW + +IP+P EL Sbjct 34 DVKHPLNTKWTLW----YTKPAVDKSESWSDLLRPVTSFQTVEEFWAIIQNIPEPHEL 87 > xla:734605 eif4e2, MGC115622; eukaryotic translation initiation factor 4E family member 2 Length=212 Score = 40.4 bits (93), Expect = 0.004, Method: Compositional matrix adjust. Identities = 17/57 (29%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Query 105 PLQHRWHVWEQIQREAAAADRAADYSQNTRDLASFDTVQTFWQLWAHIPQPSELLGH 161 PLQ+++ W +R + +Y QN R + +V+ FW++++HI +P +L G+ Sbjct 33 PLQYKYTFWYS-RRTPSRPASTHNYEQNIRPFGTVASVEQFWRIYSHIVRPGDLSGY 88 > mmu:244958 Mrap2, BB633055; melanocortin 2 receptor accessory protein 2 Length=207 Score = 38.5 bits (88), Expect = 0.013, Method: Compositional matrix adjust. Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 0/48 (0%) Query 3 FFVFFPLVLVLKRSGPEQEGARAADARFRRSSFASSAGGVCCSSPLFA 50 F+FF L L+ K P Q+ A +++ RFR +SF S G S +F+ Sbjct 60 IFMFFVLTLLTKTGAPHQDNAESSERRFRMNSFVSDFGKPLESDKVFS 107 > cel:B0348.6 ife-3; Initiation Factor 4E (eIF4E) family member (ife-3); K03259 translation initiation factor 4E Length=248 Score = 37.7 bits (86), Expect = 0.024, Method: Compositional matrix adjust. Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 6/48 (12%) Query 105 PLQHRWHVWEQIQREAAAADRAADYSQNTRDLASFDTVQTFWQLWAHI 152 PLQ+RW +W ADR ++ + ++ FDTV+ FW L+ HI Sbjct 33 PLQNRWALW------YLKADRNKEWEDCLKMVSLFDTVEDFWSLYNHI 74 > hsa:112609 MRAP2, C6orf117, RP11-51G5.2, bA51G5.2; melanocortin 2 receptor accessory protein 2 Length=205 Score = 37.4 bits (85), Expect = 0.029, Method: Compositional matrix adjust. Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 0/38 (0%) Query 3 FFVFFPLVLVLKRSGPEQEGARAADARFRRSSFASSAG 40 F+FF L L+ K P Q+ A +++ RFR +SF S G Sbjct 58 IFMFFVLTLLTKTGAPHQDNAESSEKRFRMNSFVSDFG 95 > mmu:218268 Eif4e1b, AA473955, Eif4eloo, Gm273; eukaryotic translation initiation factor 4E family member 1B; K03259 translation initiation factor 4E Length=244 Score = 37.0 bits (84), Expect = 0.037, Method: Compositional matrix adjust. Identities = 18/54 (33%), Positives = 30/54 (55%), Gaps = 6/54 (11%) Query 105 PLQHRWHVWEQIQREAAAADRAADYSQNTRDLASFDTVQTFWQLWAHIPQPSEL 158 PLQ+RW +W DR+ + N + + F+TV+ FW +++HI S+L Sbjct 66 PLQYRWVLW------FFKNDRSRAWQDNLQLVTKFNTVEDFWAVYSHIKLASKL 113 > hsa:253314 EIF4E1B, FLJ36951; eukaryotic translation initiation factor 4E family member 1B; K03259 translation initiation factor 4E Length=242 Score = 37.0 bits (84), Expect = 0.040, Method: Compositional matrix adjust. Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 6/54 (11%) Query 105 PLQHRWHVWEQIQREAAAADRAADYSQNTRDLASFDTVQTFWQLWAHIPQPSEL 158 PLQ+RW +W DR+ + N + DTV+ FW L++HI S+L Sbjct 63 PLQNRWALW------FFKNDRSRAWQDNLHLVTKVDTVEDFWALYSHIQLASKL 110 > ath:AT5G18110 NCBP; NCBP (NOVEL CAP-BINDING PROTEIN); RNA binding / translation initiation factor; K03259 translation initiation factor 4E Length=221 Score = 35.8 bits (81), Expect = 0.075, Method: Compositional matrix adjust. Identities = 25/104 (24%), Positives = 46/104 (44%), Gaps = 21/104 (20%) Query 81 NPSVADAVNLD--------ECITEERPA----DAPMPLQHRWHVWEQIQREAAAADRAAD 128 + + D+ N+D + ++EER + D PL++++ +W + R Sbjct 8 DDEIRDSGNMDSIKSHYVTDSVSEERRSRELKDGDHPLRYKFSIWYTRRTPGV---RNQS 64 Query 129 YSQNTRDLASFDTVQTFWQLWAH------IPQPSELLGHKRMIR 166 Y N + + F TV+ FW + H +P P++L K IR Sbjct 65 YEDNIKKMVEFSTVEGFWACYCHLARSSLLPSPTDLHFFKDGIR 108 > ath:AT4G18040 EIF4E; EIF4E (EUKARYOTIC TRANSLATION INITATION FACTOR 4E); RNA binding / RNA cap binding / protein binding / translation initiation factor; K03259 translation initiation factor 4E Length=235 Score = 34.7 bits (78), Expect = 0.17, Method: Compositional matrix adjust. Identities = 20/70 (28%), Positives = 32/70 (45%), Gaps = 5/70 (7%) Query 89 NLDECITEERPADAPMPLQHRWHVWEQIQREAAAADRAADYSQNTRDLASFDTVQTFWQL 148 N+DE P PL+H W W A + + + R + +F TV+ FW L Sbjct 47 NVDESSKSGVPES--HPLEHSWTFWFD---NPAVKSKQTSWGSSLRPVFTFSTVEEFWSL 101 Query 149 WAHIPQPSEL 158 + ++ PS+L Sbjct 102 YNNMKHPSKL 111 > mmu:66892 Eif4e3, 1300018P11Rik, AI451927, eIF4E-3; eukaryotic translation initiation factor 4E member 3 Length=207 Score = 34.7 bits (78), Expect = 0.21, Method: Compositional matrix adjust. Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 3/69 (4%) Query 90 LDECITEERPADAPMPLQHRWHVWEQIQREAAAADRAADYSQNTRDLASFDTVQTFWQLW 149 LD+ ++ P +PL W W + R A AA+ + N + + + TVQ FW ++ Sbjct 16 LDKALSALPPEPGGVPLHSPWTFW--LDRSLPGAT-AAECASNLKKIYTVQTVQIFWSVY 72 Query 150 AHIPQPSEL 158 +IP + L Sbjct 73 NNIPPVTSL 81 > dre:447850 eif4e3, wu:fc31f11, wu:fd15f11, zgc:92189; eukaryotic translation initiation factor 4E family member 3 Length=224 Score = 31.2 bits (69), Expect = 1.9, Method: Compositional matrix adjust. Identities = 20/75 (26%), Positives = 35/75 (46%), Gaps = 7/75 (9%) Query 83 SVADAVNLDE----CITEERPADAPMPLQHRWHVWEQIQREAAAADRAADYSQNTRDLAS 138 S + +++DE IT +PL W W + R + AA+ N + + + Sbjct 22 STENDIHIDERELENITNHVEDGTSLPLHSPWTFW--LDR-SLPGTTAAECESNLKKIYT 78 Query 139 FDTVQTFWQLWAHIP 153 TVQ+FW ++ +IP Sbjct 79 VHTVQSFWSVYNNIP 93 > ath:AT5G35620 LSP1; LSP1 (LOSS OF SUSCEPTIBILITY TO POTYVIRUS 1); RNA 7-methylguanosine cap binding / RNA binding / translation initiation factor Length=198 Score = 31.2 bits (69), Expect = 2.2, Method: Compositional matrix adjust. Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 5/62 (8%) Query 103 PMPLQHRWHVWEQIQREAAAADRAADYSQNTRDLASFDTVQTFWQLWAHIPQPSELLGHK 162 P L+ +W W Q + AA + + R +FDTV+ FW L I Q S+L + Sbjct 25 PHKLERKWSFWFDNQSKKGAA-----WGASLRKAYTFDTVEDFWGLHETIFQTSKLTANA 79 Query 163 RM 164 + Sbjct 80 EI 81 > tgo:TGME49_010780 ubiquitin carboxyl-terminal hydrolase, putative (EC:3.1.2.15) Length=4302 Score = 30.8 bits (68), Expect = 2.5, Method: Compositional matrix adjust. Identities = 23/82 (28%), Positives = 31/82 (37%), Gaps = 16/82 (19%) Query 66 CCCFWTMASTKYLSFNPSVADAVNLDECITEERPADAPMPLQHRWHV--WEQIQREAAAA 123 C CF ++ +LS I P D PM RWH WE + +A Sbjct 3669 CACFLSLRMEDFLS--------------IAHGNPLDGPMAETPRWHPAEWEAVLGNMESA 3714 Query 124 DRAADYSQNTRDLASFDTVQTF 145 D+SQ+ + AS TF Sbjct 3715 VLKIDFSQSLGNWASIREQSTF 3736 > xla:414635 eif4e3-b, MGC81298, eif4e3; eukaryotic translation initiation factor 4E family member 3 Length=218 Score = 30.8 bits (68), Expect = 2.8, Method: Compositional matrix adjust. Identities = 19/69 (27%), Positives = 32/69 (46%), Gaps = 3/69 (4%) Query 90 LDECITEERPADAPMPLQHRWHVWEQIQREAAAADRAADYSQNTRDLASFDTVQTFWQLW 149 L E + P +PL W W + R + AA+ N + + + T+Q+FW ++ Sbjct 27 LGELDLPQEPDTEGIPLNSPWTFW--LDR-SLPGTTAAECESNLKKIYTVHTIQSFWSVY 83 Query 150 AHIPQPSEL 158 +IP S L Sbjct 84 NNIPLVSNL 92 > cel:F53A2.6 ife-1; Initiation Factor 4E (eIF4E) family member (ife-1); K03259 translation initiation factor 4E Length=212 Score = 30.0 bits (66), Expect = 4.6, Method: Compositional matrix adjust. Identities = 19/66 (28%), Positives = 29/66 (43%), Gaps = 7/66 (10%) Query 94 ITEERPADAPM-PLQHRWHVWEQIQREAAAADRAADYSQNTRDLASFDTVQTFWQLWAHI 152 +TE AP+ PL+ W W +R + + + +F+TV FW L+ I Sbjct 1 MTETEQTTAPIYPLKRNWTWW------YLNDERNKSWEDRLKKVYTFNTVSEFWALYDAI 54 Query 153 PQPSEL 158 PS L Sbjct 55 RPPSGL 60 > cel:Y57A10A.30 ife-5; Initiation Factor 4E (eIF4E) family member (ife-5); K03259 translation initiation factor 4E Length=201 Score = 29.3 bits (64), Expect = 6.9, Method: Compositional matrix adjust. Identities = 17/54 (31%), Positives = 23/54 (42%), Gaps = 6/54 (11%) Query 105 PLQHRWHVWEQIQREAAAADRAADYSQNTRDLASFDTVQTFWQLWAHIPQPSEL 158 PLQ W W DR A + + + +F+TV FW + I PS L Sbjct 10 PLQRNWSWW------FLNDDRNASWQDRLKKVYTFNTVPEFWAFYEAILPPSGL 57 > xla:443785 eif4e3-a, MGC81435; eukaryotic translation initiation factor 4E family member 3 Length=218 Score = 29.3 bits (64), Expect = 7.7, Method: Compositional matrix adjust. Identities = 16/65 (24%), Positives = 31/65 (47%), Gaps = 3/65 (4%) Query 89 NLDECITEERPADAPMPLQHRWHVWEQIQREAAAADRAADYSQNTRDLASFDTVQTFWQL 148 ++ E + P +PL W W + R + AA+ N + + + T+Q+FW + Sbjct 26 DIGELGLPQEPDTEGIPLHSPWTFW--LDR-SLPGTTAAECESNLKKIYTVHTIQSFWSV 82 Query 149 WAHIP 153 + +IP Sbjct 83 YNNIP 87 Lambda K H 0.326 0.134 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 4976880524 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40