bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_2395_orf1 Length=179 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_116900 hypothetical protein ; K14765 U3 small nucle... 96.3 5e-20 pfa:PF13_0181 conserved Plasmodium protein, unknown function 32.0 1.0 pfa:PFC1015c conserved Plasmodium protein, unknown function 30.8 2.5 sce:YML088W UFO1; F-box receptor protein, subunit of the Skp1-... 30.0 5.0 ath:AT1G53470 MSL4; MSL4 (MECHANOSENSITIVE CHANNEL OF SMALL CO... 29.3 7.6 ath:AT2G32050 cell cycle control protein-related 28.9 8.6 sce:YOR141C ARP8; Arp8p; K11673 actin-related protein 8 28.9 tgo:TGME49_060220 folate/methotrexate transporter, putative 28.9 9.3 > tgo:TGME49_116900 hypothetical protein ; K14765 U3 small nucleolar ribonucleoprotein protein LCP5 Length=800 Score = 96.3 bits (238), Expect = 5e-20, Method: Compositional matrix adjust. Identities = 64/168 (38%), Positives = 103/168 (61%), Gaps = 20/168 (11%) Query 1 RREMVRAVKEMTGDAPEEVGIERWL---------AAKAHKEAAREAGLVGDDEDMQLMRR 51 R E+VRAV+E GDAPEEVG+E+W+ AA K+ AREA E+ ++R Sbjct 479 RSELVRAVREEVGDAPEEVGLEQWIQVQQSRLGSAASIAKQRAREAF-----EEENMVRL 533 Query 52 SLSKKERKVQAAQRALFERRAALSVGSTLEDLSIFCEEELGGVGEDDDGPFDLQSRGKG- 110 S+SKK+RK + + L E + ++VG+TL +L+ F E L +G+D++ P + G+ Sbjct 534 SMSKKDRKERQMSKKLEEHQRRMTVGTTLGELTAFSESTLDALGDDEEDP----TLGRAN 589 Query 111 KEKTRGRGMLSHYLNAAKQAAEENKKLNKAF-AEKLVIARQQNLQHLN 157 K K + + L+ YLNAAKQA+E ++ A A++ +++RQ+N + L+ Sbjct 590 KSKKKQKNALNAYLNAAKQASETARRAEAALQADRAILSRQENQKTLS 637 > pfa:PF13_0181 conserved Plasmodium protein, unknown function Length=871 Score = 32.0 bits (71), Expect = 1.0, Method: Composition-based stats. Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 0/45 (0%) Query 134 NKKLNKAFAEKLVIARQQNLQHLNRKNHKEMDKSAPKKNDSRVGR 178 N K NK K I++Q N+ + N K + + + P N SR+ R Sbjct 384 NIKKNKEMMNKTNISKQTNISNNNHKKYDTFNNNIPIHNTSRISR 428 > pfa:PFC1015c conserved Plasmodium protein, unknown function Length=2340 Score = 30.8 bits (68), Expect = 2.5, Method: Composition-based stats. Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 10/49 (20%) Query 127 AKQAAEENKKLNKAFAEKLVIARQQNLQHLNRKNHKEMDKSAPKKNDSR 175 KQ A++N K N +QN + +++NHK+ DK K+ND + Sbjct 787 GKQNAKQNDKHND----------KQNDKQNDKQNHKQYDKQNDKQNDKQ 825 > sce:YML088W UFO1; F-box receptor protein, subunit of the Skp1-Cdc53-F-box receptor (SCF) E3 ubiquitin ligase complex; binds to phosphorylated Ho endonuclease, allowing its ubiquitylation by SCF and subsequent degradation; K15073 ubiquitin ligase complex F-box protein UFO1 Length=668 Score = 30.0 bits (66), Expect = 5.0, Method: Composition-based stats. Identities = 25/53 (47%), Positives = 33/53 (62%), Gaps = 6/53 (11%) Query 10 EMTGDAPEEVGIERWLAAKAHKEA-AR---EAGL-VGDDEDMQLMRRSLSKKE 57 E++GD EE I+ +A +EA AR EAG VGDDED QL RR+L + + Sbjct 509 ELSGDTDEENDIQLRIALLESQEAQARNQAEAGEPVGDDEDEQL-RRALEESQ 560 > ath:AT1G53470 MSL4; MSL4 (MECHANOSENSITIVE CHANNEL OF SMALL CONDUCTANCE-LIKE 4) Length=881 Score = 29.3 bits (64), Expect = 7.6, Method: Composition-based stats. Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Query 95 GEDDDGPFDLQSRG--KGKEKTRGRGMLSHYLNAAKQAAEE 133 GE+DDG FD R K +E +++ +LN K + +E Sbjct 47 GEEDDGSFDFMRRSSEKSEEPDPPSKLINQFLNKQKASGDE 87 > ath:AT2G32050 cell cycle control protein-related Length=254 Score = 28.9 bits (63), Expect = 8.6, Method: Compositional matrix adjust. Identities = 21/48 (43%), Positives = 29/48 (60%), Gaps = 4/48 (8%) Query 41 GDDEDMQLMRRSL-SKKERKVQAA---QRALFERRAALSVGSTLEDLS 84 G D L +R+L SK+E V AA +++ RR ++SV S LEDLS Sbjct 120 GGDRMSSLEKRTLVSKREVDVMAALDEMKSMKSRRVSVSVDSMLEDLS 167 > sce:YOR141C ARP8; Arp8p; K11673 actin-related protein 8 Length=881 Score = 28.9 bits (63), Expect = 9.1, Method: Composition-based stats. Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 4/44 (9%) Query 122 HYLNAAKQAAEENKKLNKA-FAEKLV---IARQQNLQHLNRKNH 161 HY+NA + +ENK++ +A EK+V + QN++H N H Sbjct 780 HYVNAPDKTEDENKQILQAQIKEKIVEELEEQHQNIEHQNGNEH 823 > tgo:TGME49_060220 folate/methotrexate transporter, putative Length=1056 Score = 28.9 bits (63), Expect = 9.3, Method: Composition-based stats. Identities = 25/97 (25%), Positives = 45/97 (46%), Gaps = 11/97 (11%) Query 28 KAHKEAAREAGLVGDDEDMQLMRRSLSKKER--KVQAAQRALFERRAA--------LSVG 77 + EA EAG+ D+ + RR++ ++ R KV + AL E R + G Sbjct 525 RRESEAGAEAGVSSDEATRDVHRRTVERRTRGGKVAETELALMETRGENRTRARENRTFG 584 Query 78 STLED-LSIFCEEELGGVGEDDDGPFDLQSRGKGKEK 113 + + LS +E+ GG ++D+ + R G+E+ Sbjct 585 ACVHHALSTTDDEDSGGYRDEDEFDATRKPRIFGRER 621 Lambda K H 0.312 0.128 0.348 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 4795148792 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40