bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_2426_orf1 Length=165 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_105010 RNA binding protein, putative ; K12833 pre-m... 82.8 5e-16 bbo:BBOV_II005820 18.m06483; pre-mRNA branch site protein p14;... 79.7 4e-15 pfa:PFL1200c splicing factor 3b subunit, putative; K12833 pre-... 72.4 6e-13 xla:379631 sf3b14, MGC68842; splicing factor 3B, 14 kDa subuni... 72.4 7e-13 ath:AT5G12190 RNA recognition motif (RRM)-containing protein; ... 72.0 8e-13 dre:415157 sf3b14, zgc:86708; splicing factor 3B; K12833 pre-m... 70.1 3e-12 mmu:66055 0610009D07Rik, 6030419K15Rik, AV001342, Sf3b14; RIKE... 70.1 3e-12 hsa:51639 SF3B14, HSPC175, Ht006, P14, SAP14, SF3B14a; splicin... 70.1 3e-12 cel:C50D2.5 hypothetical protein; K12833 pre-mRNA branch site ... 65.1 1e-10 ath:AT2G14870 RNA recognition motif (RRM)-containing protein 58.9 8e-09 tpv:TP02_0539 hypothetical protein; K12833 pre-mRNA branch sit... 54.7 1e-07 cpv:cgd3_2310 hypothetical protein ; K12833 pre-mRNA branch si... 52.0 9e-07 pfa:PF10_0217 pre-mRNA splicing factor, putative 39.3 0.006 hsa:85437 ZCRB1, MADP-1, MADP1, MGC26805, RBM36, ZCCHC19; zinc... 37.4 0.022 mmu:67197 Zcrb1, 2700088M22Rik, Madp-1; zinc finger CCHC-type ... 37.4 0.023 pfa:PFL0830w RNA binding protein, putative; K14787 multiple RN... 36.6 0.035 ath:AT1G71770 PAB5; PAB5 (POLY(A)-BINDING PROTEIN 5); RNA bind... 36.2 0.057 ath:AT5G07290 AML4; AML4 (ARABIDOPSIS MEI2-LIKE 4); RNA bindin... 35.8 0.066 xla:446310 zcrb1, MGC82154; zinc finger CCHC-type and RNA bind... 35.8 0.075 ath:AT1G02840 SR1; SR1; RNA binding / nucleic acid binding / n... 35.4 0.083 xla:495336 hypothetical LOC495336 35.0 0.11 cpv:cgd5_2200 T8M16_190-plant like protein with RRM domain 35.0 0.12 ath:AT4G19610 RNA binding / nucleic acid binding / nucleotide ... 35.0 0.12 bbo:BBOV_II005790 18.m06481; u1 snRNP; K11093 U1 small nuclear... 34.7 0.17 dre:322667 fb69f10; wu:fb69f10 34.3 0.17 ath:AT4G02430 pre-mRNA splicing factor, putative / SR1 protein... 34.3 0.18 ath:AT3G49430 SRp34a; SRp34a (Ser/Arg-rich protein 34a); RNA b... 34.3 0.22 xla:431797 rbm15, MGC83913; RNA binding motif protein 15; K131... 33.5 0.29 dre:406288 srsf1a, sfrs1a, sfrs1l, wu:fb52g10, wu:fb97g12, zgc... 33.5 0.33 pfa:PFI1600w mRNA processing protein, putative 33.1 0.38 hsa:6426 SRSF1, ASF, FLJ53078, MGC5228, SF2, SF2p33, SFRS1, SR... 33.1 0.39 mmu:110809 Srsf1, 1110054N12Rik, 5730507C05Rik, 6330415C05Rik,... 33.1 0.41 dre:393565 srsf1b, MGC65898, sfrs1, sfrs1b, wu:fb80g05, zgc:11... 33.1 0.42 dre:405835 MGC77449; zgc:77449; K12890 splicing factor, argini... 33.1 0.46 xla:495254 srsf9, sfrs9, srp30c; serine/arginine-rich splicing... 33.1 0.47 mmu:74111 Rbm19, 1200009A02Rik, AV302714, KIAA0682, NPO; RNA b... 33.1 0.48 tgo:TGME49_089560 nuclear cap-binding protein, putative ; K128... 32.7 0.49 hsa:8683 SRSF9, SFRS9, SRp30c; serine/arginine-rich splicing f... 32.7 0.50 cel:F26A3.2 ncbp-2; Nuclear Cap-Binding Protein family member ... 32.7 0.61 mmu:108014 Srsf9, 25kDa, 2610029M16Rik, SRp30c, Sfrs9; serine/... 32.7 0.61 ath:AT4G34110 PAB2; PAB2 (POLY(A) BINDING 2); RNA binding / tr... 32.3 0.66 mmu:12387 Ctnnb1, Bfc, Catnb, Mesc; catenin (cadherin associat... 32.3 0.69 hsa:1499 CTNNB1, CTNNB, DKFZp686D02253, FLJ25606, FLJ37923; ca... 32.3 0.70 hsa:9904 RBM19, DKFZp586F1023, KIAA0682; RNA binding motif pro... 32.3 0.72 ath:AT1G22760 PAB3; PAB3 (POLY(A) BINDING PROTEIN 3); RNA bind... 32.3 0.73 xla:494769 rbm19; RNA binding motif protein 19; K14787 multipl... 32.3 0.76 hsa:10146 G3BP1, G3BP, HDH-VIII, MGC111040; GTPase activating ... 32.0 0.98 dre:100330634 RNA binding motif protein 12-like 32.0 1.0 ath:AT3G52380 CP33; CP33; RNA binding 32.0 1.1 cel:B0035.12 hypothetical protein 31.6 1.1 > tgo:TGME49_105010 RNA binding protein, putative ; K12833 pre-mRNA branch site protein p14 Length=156 Score = 82.8 bits (203), Expect = 5e-16, Method: Compositional matrix adjust. Identities = 32/49 (65%), Positives = 44/49 (89%), Gaps = 0/49 (0%) Query 117 LAGRGRPQRLAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQIRRGT 165 ++ RGRP ++AP++SRI+YVRNLPFKI +ELYD+FGKYG++RQIR+G Sbjct 37 VSTRGRPTKIAPDMSRIIYVRNLPFKITDDELYDIFGKYGAVRQIRKGN 85 > bbo:BBOV_II005820 18.m06483; pre-mRNA branch site protein p14; K12833 pre-mRNA branch site protein p14 Length=122 Score = 79.7 bits (195), Expect = 4e-15, Method: Compositional matrix adjust. Identities = 33/44 (75%), Positives = 40/44 (90%), Gaps = 0/44 (0%) Query 122 RPQRLAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQIRRGT 165 R RL+PEVSRILY+RNLP+KI+ EELYD+FGKYGS+RQIR+G Sbjct 10 RTMRLSPEVSRILYLRNLPYKISAEELYDIFGKYGSVRQIRKGN 53 > pfa:PFL1200c splicing factor 3b subunit, putative; K12833 pre-mRNA branch site protein p14 Length=106 Score = 72.4 bits (176), Expect = 6e-13, Method: Compositional matrix adjust. Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 0/44 (0%) Query 122 RPQRLAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQIRRGT 165 R RL EVSRILYVRNLP+KI+ +ELYD+FGKYG++RQIR+G Sbjct 4 RNIRLPAEVSRILYVRNLPYKISADELYDIFGKYGTVRQIRKGN 47 > xla:379631 sf3b14, MGC68842; splicing factor 3B, 14 kDa subunit; K12833 pre-mRNA branch site protein p14 Length=125 Score = 72.4 bits (176), Expect = 7e-13, Method: Compositional matrix adjust. Identities = 31/41 (75%), Positives = 36/41 (87%), Gaps = 0/41 (0%) Query 125 RLAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQIRRGT 165 RL PEV+RILY+RNLP+KI GEE+YD+FGKYG IRQIR G Sbjct 12 RLPPEVNRILYIRNLPYKITGEEMYDIFGKYGPIRQIRVGN 52 > ath:AT5G12190 RNA recognition motif (RRM)-containing protein; K12833 pre-mRNA branch site protein p14 Length=124 Score = 72.0 bits (175), Expect = 8e-13, Method: Compositional matrix adjust. Identities = 31/45 (68%), Positives = 36/45 (80%), Gaps = 0/45 (0%) Query 120 RGRPQRLAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQIRRG 164 R RL PEV+R+LYVRNLPF I EE+YD+FGKYG+IRQIR G Sbjct 7 RKSNTRLPPEVNRVLYVRNLPFNITSEEMYDIFGKYGAIRQIRIG 51 > dre:415157 sf3b14, zgc:86708; splicing factor 3B; K12833 pre-mRNA branch site protein p14 Length=125 Score = 70.1 bits (170), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%) Query 125 RLAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQIRRGT 165 RL PEV+RILY+RNLP+KI EE+YD+FGKYG IRQIR G Sbjct 12 RLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGN 52 > mmu:66055 0610009D07Rik, 6030419K15Rik, AV001342, Sf3b14; RIKEN cDNA 0610009D07 gene; K12833 pre-mRNA branch site protein p14 Length=125 Score = 70.1 bits (170), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%) Query 125 RLAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQIRRGT 165 RL PEV+RILY+RNLP+KI EE+YD+FGKYG IRQIR G Sbjct 12 RLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGN 52 > hsa:51639 SF3B14, HSPC175, Ht006, P14, SAP14, SF3B14a; splicing factor 3B, 14 kDa subunit; K12833 pre-mRNA branch site protein p14 Length=125 Score = 70.1 bits (170), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%) Query 125 RLAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQIRRGT 165 RL PEV+RILY+RNLP+KI EE+YD+FGKYG IRQIR G Sbjct 12 RLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGN 52 > cel:C50D2.5 hypothetical protein; K12833 pre-mRNA branch site protein p14 Length=138 Score = 65.1 bits (157), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 26/45 (57%), Positives = 37/45 (82%), Gaps = 0/45 (0%) Query 121 GRPQRLAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQIRRGT 165 R +L PEV+RILY++NLP+KI EE+Y++FGK+G++RQIR G Sbjct 8 NRGAKLPPEVNRILYIKNLPYKITTEEMYEIFGKFGAVRQIRVGN 52 > ath:AT2G14870 RNA recognition motif (RRM)-containing protein Length=101 Score = 58.9 bits (141), Expect = 8e-09, Method: Compositional matrix adjust. Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%) Query 125 RLAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQIRRG 164 RL PEV+R+LY+ NLPF I E+ YD+FG+Y +IRQ+R G Sbjct 13 RLPPEVTRLLYICNLPFSITSEDTYDLFGRYSTIRQVRIG 52 > tpv:TP02_0539 hypothetical protein; K12833 pre-mRNA branch site protein p14 Length=134 Score = 54.7 bits (130), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 26/53 (49%), Positives = 32/53 (60%), Gaps = 10/53 (18%) Query 123 PQRLAPEVSRILYVR----------NLPFKINGEELYDVFGKYGSIRQIRRGT 165 P EV R + +R NLP+KI EELYD+FGKYGS+RQIR+G Sbjct 13 PTTFGLEVQRAIQLRHGGSSKTSNLNLPYKITSEELYDIFGKYGSVRQIRKGN 65 > cpv:cgd3_2310 hypothetical protein ; K12833 pre-mRNA branch site protein p14 Length=86 Score = 52.0 bits (123), Expect = 9e-07, Method: Compositional matrix adjust. Identities = 20/35 (57%), Positives = 29/35 (82%), Gaps = 0/35 (0%) Query 131 SRILYVRNLPFKINGEELYDVFGKYGSIRQIRRGT 165 S I+Y+R LP+ I+ +LYD+FG++G+IRQIRRG Sbjct 15 SSIIYLRQLPYDISSTDLYDIFGRHGTIRQIRRGV 49 > pfa:PF10_0217 pre-mRNA splicing factor, putative Length=538 Score = 39.3 bits (90), Expect = 0.006, Method: Composition-based stats. Identities = 17/31 (54%), Positives = 22/31 (70%), Gaps = 0/31 (0%) Query 131 SRILYVRNLPFKINGEELYDVFGKYGSIRQI 161 S +YV NLP + EE+YD+FGKYG I+ I Sbjct 11 SSCIYVGNLPGNVIEEEVYDLFGKYGRIKYI 41 > hsa:85437 ZCRB1, MADP-1, MADP1, MGC26805, RBM36, ZCCHC19; zinc finger CCHC-type and RNA binding motif 1; K13154 U11/U12 small nuclear ribonucleoprotein 31 kDa protein Length=217 Score = 37.4 bits (85), Expect = 0.022, Method: Compositional matrix adjust. Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Query 126 LAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQI 161 LAP S + YV NLPF + +LY +F KYG + ++ Sbjct 5 LAPSKSTV-YVSNLPFSLTNNDLYRIFSKYGKVVKV 39 > mmu:67197 Zcrb1, 2700088M22Rik, Madp-1; zinc finger CCHC-type and RNA binding motif 1; K13154 U11/U12 small nuclear ribonucleoprotein 31 kDa protein Length=217 Score = 37.4 bits (85), Expect = 0.023, Method: Compositional matrix adjust. Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Query 126 LAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQI 161 LAP S + YV NLPF + +LY +F KYG + ++ Sbjct 5 LAPSKSTV-YVSNLPFSLTNNDLYRIFSKYGKVVKV 39 > pfa:PFL0830w RNA binding protein, putative; K14787 multiple RNA-binding domain-containing protein 1 Length=1119 Score = 36.6 bits (83), Expect = 0.035, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 25/34 (73%), Gaps = 0/34 (0%) Query 129 EVSRILYVRNLPFKINGEELYDVFGKYGSIRQIR 162 +V++ L V+NL F++N EEL +F +G+++ +R Sbjct 980 QVTKKLVVKNLAFQVNKEELRKLFSAFGNVKSVR 1013 > ath:AT1G71770 PAB5; PAB5 (POLY(A)-BINDING PROTEIN 5); RNA binding / poly(A) binding / translation initiation factor Length=668 Score = 36.2 bits (82), Expect = 0.057, Method: Compositional matrix adjust. Identities = 14/25 (56%), Positives = 18/25 (72%), Gaps = 0/25 (0%) Query 134 LYVRNLPFKINGEELYDVFGKYGSI 158 +YV+NLP +I +EL FGKYG I Sbjct 227 VYVKNLPKEITDDELKKTFGKYGDI 251 Score = 30.4 bits (67), Expect = 2.8, Method: Compositional matrix adjust. Identities = 10/25 (40%), Positives = 19/25 (76%), Gaps = 0/25 (0%) Query 134 LYVRNLPFKINGEELYDVFGKYGSI 158 LY++NL +N E+L ++F +YG++ Sbjct 330 LYLKNLDDSVNDEKLKEMFSEYGNV 354 > ath:AT5G07290 AML4; AML4 (ARABIDOPSIS MEI2-LIKE 4); RNA binding / nucleic acid binding / nucleotide binding Length=907 Score = 35.8 bits (81), Expect = 0.066, Method: Composition-based stats. Identities = 15/30 (50%), Positives = 21/30 (70%), Gaps = 0/30 (0%) Query 134 LYVRNLPFKINGEELYDVFGKYGSIRQIRR 163 L+V NL I+ EEL+ +F YG IR++RR Sbjct 297 LWVNNLDSSISNEELHGIFSSYGEIREVRR 326 > xla:446310 zcrb1, MGC82154; zinc finger CCHC-type and RNA binding motif 1; K13154 U11/U12 small nuclear ribonucleoprotein 31 kDa protein Length=218 Score = 35.8 bits (81), Expect = 0.075, Method: Compositional matrix adjust. Identities = 15/36 (41%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Query 126 LAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQI 161 LAP S + YV NLPF + +L+ +F KYG + ++ Sbjct 5 LAPSKSTV-YVSNLPFSLTNNDLHRIFSKYGKVVKV 39 > ath:AT1G02840 SR1; SR1; RNA binding / nucleic acid binding / nucleotide binding; K12890 splicing factor, arginine/serine-rich 1/9 Length=303 Score = 35.4 bits (80), Expect = 0.083, Method: Compositional matrix adjust. Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 0/36 (0%) Query 126 LAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQI 161 ++ SR +YV NLP I E+ D+F KYG + QI Sbjct 1 MSSRSSRTVYVGNLPGDIREREVEDLFSKYGPVVQI 36 > xla:495336 hypothetical LOC495336 Length=711 Score = 35.0 bits (79), Expect = 0.11, Method: Compositional matrix adjust. Identities = 22/79 (27%), Positives = 40/79 (50%), Gaps = 1/79 (1%) Query 81 FAGCSLSGVPRECCGAAAAAAAAAAAKSPAMQPAPLLAGRGRPQRLAPEVSRI-LYVRNL 139 A +++ + + G + A+ A K + L + + +R + VS + LYV+NL Sbjct 233 HAEAAVAAMHGKEIGGRSLYASRAQRKEERQEELKLRLEKQKAERRSKYVSNVNLYVKNL 292 Query 140 PFKINGEELYDVFGKYGSI 158 +I+ E L ++F KYG I Sbjct 293 DDEIDDERLKEIFSKYGPI 311 > cpv:cgd5_2200 T8M16_190-plant like protein with RRM domain Length=600 Score = 35.0 bits (79), Expect = 0.12, Method: Composition-based stats. Identities = 12/29 (41%), Positives = 20/29 (68%), Gaps = 0/29 (0%) Query 132 RILYVRNLPFKINGEELYDVFGKYGSIRQ 160 R LY++NLPF N E + +VF ++G + + Sbjct 97 RRLYIKNLPFSANTESVIEVFSQFGDVEE 125 Score = 33.5 bits (75), Expect = 0.35, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 21/31 (67%), Gaps = 0/31 (0%) Query 130 VSRILYVRNLPFKINGEELYDVFGKYGSIRQ 160 + R L+VRNL F+ N + L +V G+YG + + Sbjct 183 IRRKLFVRNLGFETNEDSLSEVMGQYGELEE 213 > ath:AT4G19610 RNA binding / nucleic acid binding / nucleotide binding; K14787 multiple RNA-binding domain-containing protein 1 Length=816 Score = 35.0 bits (79), Expect = 0.12, Method: Composition-based stats. Identities = 15/29 (51%), Positives = 21/29 (72%), Gaps = 0/29 (0%) Query 133 ILYVRNLPFKINGEELYDVFGKYGSIRQI 161 IL V+NLPF +EL +FGK+GS+ +I Sbjct 489 ILLVKNLPFASTEKELAQMFGKFGSLDKI 517 Score = 31.6 bits (70), Expect = 1.4, Method: Composition-based stats. Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 0/28 (0%) Query 134 LYVRNLPFKINGEELYDVFGKYGSIRQI 161 L+VRNLP+ EEL + F +G I ++ Sbjct 296 LFVRNLPYTATEEELMEHFSTFGKISEV 323 > bbo:BBOV_II005790 18.m06481; u1 snRNP; K11093 U1 small nuclear ribonucleoprotein 70kDa Length=247 Score = 34.7 bits (78), Expect = 0.17, Method: Compositional matrix adjust. Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 2/61 (3%) Query 102 AAAAAKSPAMQPAPLLAGRGRPQRLAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQI 161 A A P PA L G P L + + L+V N+P+++ ++L+ F YG +R+I Sbjct 79 AERDAYDPKYDPA-LARGATNPW-LTHDPYKTLFVSNIPYEVTEKQLWKEFDVYGRVRRI 136 Query 162 R 162 R Sbjct 137 R 137 > dre:322667 fb69f10; wu:fb69f10 Length=3136 Score = 34.3 bits (77), Expect = 0.17, Method: Compositional matrix adjust. Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 0/41 (0%) Query 121 GRPQRLAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQI 161 GR P+ +R L++ NL N ++L DVF ++G I I Sbjct 430 GRIDEFHPKATRTLFIGNLEKTTNYQQLLDVFQRFGEIVDI 470 > ath:AT4G02430 pre-mRNA splicing factor, putative / SR1 protein, putative Length=278 Score = 34.3 bits (77), Expect = 0.18, Method: Compositional matrix adjust. Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 0/36 (0%) Query 126 LAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQI 161 ++ SR +YV NLP I E+ D+F KYG + QI Sbjct 1 MSSRSSRTIYVGNLPGDIREREVEDLFSKYGPVVQI 36 > ath:AT3G49430 SRp34a; SRp34a (Ser/Arg-rich protein 34a); RNA binding / nucleic acid binding / nucleotide binding Length=297 Score = 34.3 bits (77), Expect = 0.22, Method: Compositional matrix adjust. Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 0/36 (0%) Query 126 LAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQI 161 ++ SR +YV NLP I E+ D+F KYG I I Sbjct 1 MSGRFSRSIYVGNLPGDIREHEIEDIFYKYGRIVDI 36 > xla:431797 rbm15, MGC83913; RNA binding motif protein 15; K13190 RNA-binding protein 15 Length=830 Score = 33.5 bits (75), Expect = 0.29, Method: Compositional matrix adjust. Identities = 16/44 (36%), Positives = 27/44 (61%), Gaps = 4/44 (9%) Query 122 RPQRLAPEV----SRILYVRNLPFKINGEELYDVFGKYGSIRQI 161 R + LA E+ +R L+V NL + E+Y VFG++G+I ++ Sbjct 285 RDEDLALEIDARANRTLFVGNLDVIVKETEIYRVFGRFGTITEV 328 > dre:406288 srsf1a, sfrs1a, sfrs1l, wu:fb52g10, wu:fb97g12, zgc:66146; serine/arginine-rich splicing factor 1a; K12890 splicing factor, arginine/serine-rich 1/9 Length=245 Score = 33.5 bits (75), Expect = 0.33, Method: Compositional matrix adjust. Identities = 18/35 (51%), Positives = 23/35 (65%), Gaps = 4/35 (11%) Query 134 LYVRNLPFKINGEELYDVFGKYGSIRQI----RRG 164 +YV NLP I +++ DVF KYG+IR I RRG Sbjct 17 IYVGNLPPDIRTKDVEDVFYKYGAIRDIDLKNRRG 51 > pfa:PFI1600w mRNA processing protein, putative Length=761 Score = 33.1 bits (74), Expect = 0.38, Method: Composition-based stats. Identities = 12/29 (41%), Positives = 19/29 (65%), Gaps = 0/29 (0%) Query 134 LYVRNLPFKINGEELYDVFGKYGSIRQIR 162 L++ N+PF I ELY++ K G +R +R Sbjct 10 LWIGNIPFDITENELYEILCKVGVVRNVR 38 > hsa:6426 SRSF1, ASF, FLJ53078, MGC5228, SF2, SF2p33, SFRS1, SRp30a; serine/arginine-rich splicing factor 1; K12890 splicing factor, arginine/serine-rich 1/9 Length=201 Score = 33.1 bits (74), Expect = 0.39, Method: Compositional matrix adjust. Identities = 18/35 (51%), Positives = 23/35 (65%), Gaps = 4/35 (11%) Query 134 LYVRNLPFKINGEELYDVFGKYGSIRQI----RRG 164 +YV NLP I +++ DVF KYG+IR I RRG Sbjct 18 IYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRG 52 > mmu:110809 Srsf1, 1110054N12Rik, 5730507C05Rik, 6330415C05Rik, AI482334, AW491331, Asf, Sf2, Sfrs1; serine/arginine-rich splicing factor 1; K12890 splicing factor, arginine/serine-rich 1/9 Length=201 Score = 33.1 bits (74), Expect = 0.41, Method: Compositional matrix adjust. Identities = 18/35 (51%), Positives = 23/35 (65%), Gaps = 4/35 (11%) Query 134 LYVRNLPFKINGEELYDVFGKYGSIRQI----RRG 164 +YV NLP I +++ DVF KYG+IR I RRG Sbjct 18 IYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRG 52 > dre:393565 srsf1b, MGC65898, sfrs1, sfrs1b, wu:fb80g05, zgc:111894, zgc:65898, zgc:76897; serine/arginine-rich splicing factor 1b; K12890 splicing factor, arginine/serine-rich 1/9 Length=245 Score = 33.1 bits (74), Expect = 0.42, Method: Compositional matrix adjust. Identities = 18/35 (51%), Positives = 23/35 (65%), Gaps = 4/35 (11%) Query 134 LYVRNLPFKINGEELYDVFGKYGSIRQI----RRG 164 +YV NLP I +++ DVF KYG+IR I RRG Sbjct 17 IYVGNLPPDIRTKDVEDVFYKYGAIRDIDLKNRRG 51 > dre:405835 MGC77449; zgc:77449; K12890 splicing factor, arginine/serine-rich 1/9 Length=244 Score = 33.1 bits (74), Expect = 0.46, Method: Compositional matrix adjust. Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 0/28 (0%) Query 134 LYVRNLPFKINGEELYDVFGKYGSIRQI 161 +YV NLP + ++ D+F KYG IR I Sbjct 6 IYVGNLPMDVQERDIEDLFFKYGKIRDI 33 > xla:495254 srsf9, sfrs9, srp30c; serine/arginine-rich splicing factor 9; K12890 splicing factor, arginine/serine-rich 1/9 Length=230 Score = 33.1 bits (74), Expect = 0.47, Method: Compositional matrix adjust. Identities = 14/28 (50%), Positives = 19/28 (67%), Gaps = 0/28 (0%) Query 134 LYVRNLPFKINGEELYDVFGKYGSIRQI 161 +YV NLP I +EL D+F +YG IR + Sbjct 18 IYVGNLPSDIREKELEDLFDRYGRIRTV 45 > mmu:74111 Rbm19, 1200009A02Rik, AV302714, KIAA0682, NPO; RNA binding motif protein 19; K14787 multiple RNA-binding domain-containing protein 1 Length=952 Score = 33.1 bits (74), Expect = 0.48, Method: Compositional matrix adjust. Identities = 13/33 (39%), Positives = 23/33 (69%), Gaps = 1/33 (3%) Query 130 VSRILYVRNLPFKINGEELYDVFGKYGSIRQIR 162 S+IL VRN+PF+ N E+ ++F +G ++ +R Sbjct 823 TSKIL-VRNIPFQANQREIRELFSTFGELKTVR 854 > tgo:TGME49_089560 nuclear cap-binding protein, putative ; K12883 nuclear cap-binding protein subunit 2 Length=282 Score = 32.7 bits (73), Expect = 0.49, Method: Compositional matrix adjust. Identities = 16/35 (45%), Positives = 24/35 (68%), Gaps = 2/35 (5%) Query 129 EVSR--ILYVRNLPFKINGEELYDVFGKYGSIRQI 161 +VSR ++YV NL F +ELY+VF + G IR++ Sbjct 29 KVSRSCVVYVGNLNFSTTEDELYEVFSQAGLIRRV 63 > hsa:8683 SRSF9, SFRS9, SRp30c; serine/arginine-rich splicing factor 9; K12890 splicing factor, arginine/serine-rich 1/9 Length=221 Score = 32.7 bits (73), Expect = 0.50, Method: Compositional matrix adjust. Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 0/28 (0%) Query 134 LYVRNLPFKINGEELYDVFGKYGSIRQI 161 +YV NLP + ++L D+F KYG IR+I Sbjct 16 IYVGNLPTDVREKDLEDLFYKYGRIREI 43 > cel:F26A3.2 ncbp-2; Nuclear Cap-Binding Protein family member (ncbp-2); K12883 nuclear cap-binding protein subunit 2 Length=154 Score = 32.7 bits (73), Expect = 0.61, Method: Compositional matrix adjust. Identities = 14/40 (35%), Positives = 24/40 (60%), Gaps = 0/40 (0%) Query 122 RPQRLAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQI 161 R Q A S LYV NL + +++Y++FG+ G +R++ Sbjct 27 RDQETALRTSCTLYVGNLSYYTKEDQVYELFGRAGDVRRV 66 > mmu:108014 Srsf9, 25kDa, 2610029M16Rik, SRp30c, Sfrs9; serine/arginine-rich splicing factor 9; K12890 splicing factor, arginine/serine-rich 1/9 Length=222 Score = 32.7 bits (73), Expect = 0.61, Method: Compositional matrix adjust. Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 0/28 (0%) Query 134 LYVRNLPFKINGEELYDVFGKYGSIRQI 161 +YV NLP + ++L D+F KYG IR+I Sbjct 17 IYVGNLPSDVREKDLEDLFYKYGRIREI 44 > ath:AT4G34110 PAB2; PAB2 (POLY(A) BINDING 2); RNA binding / translation initiation factor; K13126 polyadenylate-binding protein Length=629 Score = 32.3 bits (72), Expect = 0.66, Method: Compositional matrix adjust. Identities = 11/29 (37%), Positives = 19/29 (65%), Gaps = 0/29 (0%) Query 134 LYVRNLPFKINGEELYDVFGKYGSIRQIR 162 LYV +L F + +L+D FG+ G++ +R Sbjct 38 LYVGDLDFNVTDSQLFDAFGQMGTVVTVR 66 > mmu:12387 Ctnnb1, Bfc, Catnb, Mesc; catenin (cadherin associated protein), beta 1; K02105 catenin (cadherin-associated protein), beta 1 Length=781 Score = 32.3 bits (72), Expect = 0.69, Method: Compositional matrix adjust. Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 2/58 (3%) Query 107 KSPAMQPAPLLAGRGRPQRLAPEVSRILYVRNLPF--KINGEELYDVFGKYGSIRQIR 162 S A AP L+G+G P+ + S++LY F E++ D+ G+Y R R Sbjct 36 HSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQR 93 > hsa:1499 CTNNB1, CTNNB, DKFZp686D02253, FLJ25606, FLJ37923; catenin (cadherin-associated protein), beta 1, 88kDa; K02105 catenin (cadherin-associated protein), beta 1 Length=781 Score = 32.3 bits (72), Expect = 0.70, Method: Compositional matrix adjust. Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 2/58 (3%) Query 107 KSPAMQPAPLLAGRGRPQRLAPEVSRILYVRNLPF--KINGEELYDVFGKYGSIRQIR 162 S A AP L+G+G P+ + S++LY F E++ D+ G+Y R R Sbjct 36 HSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQR 93 > hsa:9904 RBM19, DKFZp586F1023, KIAA0682; RNA binding motif protein 19; K14787 multiple RNA-binding domain-containing protein 1 Length=960 Score = 32.3 bits (72), Expect = 0.72, Method: Composition-based stats. Identities = 18/53 (33%), Positives = 32/53 (60%), Gaps = 2/53 (3%) Query 110 AMQPAPLLAGRGRPQRLAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQIR 162 A +PA LA + + R S+IL VRN+PF+ + E+ ++F +G ++ +R Sbjct 812 ATKPAVTLARKKQVPR-KQTTSKIL-VRNIPFQAHSREIRELFSTFGELKTVR 862 Score = 30.4 bits (67), Expect = 3.1, Method: Composition-based stats. Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 0/28 (0%) Query 134 LYVRNLPFKINGEELYDVFGKYGSIRQI 161 L+VRNLP+ E+L +F KYG + ++ Sbjct 404 LFVRNLPYTSTEEDLEKLFSKYGPLSEL 431 > ath:AT1G22760 PAB3; PAB3 (POLY(A) BINDING PROTEIN 3); RNA binding / translation initiation factor Length=660 Score = 32.3 bits (72), Expect = 0.73, Method: Compositional matrix adjust. Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 0/25 (0%) Query 134 LYVRNLPFKINGEELYDVFGKYGSI 158 +YV+NLP +I +EL FGK+G I Sbjct 231 VYVKNLPKEIGEDELRKTFGKFGVI 255 > xla:494769 rbm19; RNA binding motif protein 19; K14787 multiple RNA-binding domain-containing protein 1 Length=920 Score = 32.3 bits (72), Expect = 0.76, Method: Composition-based stats. Identities = 23/64 (35%), Positives = 32/64 (50%), Gaps = 13/64 (20%) Query 107 KSPAMQPAPLLAGRGRP--QRLAPEV-------SRILYVRNLPFKINGEELYDVFGKYGS 157 KSP++Q RP QR E+ S L+VRNLP+ ++L +F KYG Sbjct 356 KSPSVQSK----AESRPWEQRDKQELQQEDLSESGRLFVRNLPYSCTEDDLDKLFSKYGP 411 Query 158 IRQI 161 I +I Sbjct 412 ISEI 415 Score = 28.9 bits (63), Expect = 7.2, Method: Composition-based stats. Identities = 11/38 (28%), Positives = 21/38 (55%), Gaps = 0/38 (0%) Query 124 QRLAPEVSRILYVRNLPFKINGEELYDVFGKYGSIRQI 161 Q P ++ V+NLP EL ++FG++G + ++ Sbjct 562 QAAGPRSKTVILVKNLPAGTKPAELQELFGRFGDLGRV 599 > hsa:10146 G3BP1, G3BP, HDH-VIII, MGC111040; GTPase activating protein (SH3 domain) binding protein 1 (EC:3.6.4.13 3.6.4.12) Length=466 Score = 32.0 bits (71), Expect = 0.98, Method: Compositional matrix adjust. Identities = 12/32 (37%), Positives = 21/32 (65%), Gaps = 0/32 (0%) Query 131 SRILYVRNLPFKINGEELYDVFGKYGSIRQIR 162 S L++ NLP +++ EL D F YG++ ++R Sbjct 339 SHQLFIGNLPHEVDKSELKDFFQSYGNVVELR 370 > dre:100330634 RNA binding motif protein 12-like Length=675 Score = 32.0 bits (71), Expect = 1.0, Method: Compositional matrix adjust. Identities = 16/33 (48%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query 124 QRLAPEVS-RILYVRNLPFKINGEELYDVFGKY 155 QR P+ R LYVRNLPF + E+ D F Y Sbjct 382 QRNTPDSQLRCLYVRNLPFDVRKVEIMDFFHGY 414 > ath:AT3G52380 CP33; CP33; RNA binding Length=329 Score = 32.0 bits (71), Expect = 1.1, Method: Compositional matrix adjust. Identities = 12/29 (41%), Positives = 19/29 (65%), Gaps = 0/29 (0%) Query 134 LYVRNLPFKINGEELYDVFGKYGSIRQIR 162 LYV NLP+ I EL +FG+ G++ ++ Sbjct 118 LYVGNLPYTITSSELSQIFGEAGTVVDVQ 146 > cel:B0035.12 hypothetical protein Length=836 Score = 31.6 bits (70), Expect = 1.1, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 22/32 (68%), Gaps = 0/32 (0%) Query 134 LYVRNLPFKINGEELYDVFGKYGSIRQIRRGT 165 ++VRN+ F+ +EL +F K+G++ +RR T Sbjct 685 VFVRNVHFQATDDELKALFSKFGTVTSVRRVT 716 Lambda K H 0.323 0.137 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 3962792044 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40