bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_2533_orf1 Length=154 Score E Sequences producing significant alignments: (Bits) Value eco:b2531 iscR, ECK2528, JW2515, yfhP; DNA-binding transcripti... 95.1 7e-20 eco:b4178 nsrR, ECK4174, JW4136, yjeB; nitric oxide-sensitive ... 49.7 3e-06 dre:568210 Ral GTPase-activating protein alpha subunit 2-like 32.3 0.61 sce:YML091C RPM2; Protein subunit of mitochondrial RNase P, ha... 30.8 1.6 ath:AT2G36810 binding 30.8 1.8 tpv:TP04_0848 hypothetical protein; K07179 RIO kinase 2 [EC:2.... 30.4 2.6 tgo:TGME49_020230 leucine rich repeat protein, putative (EC:2.... 29.6 4.5 hsa:545 ATR, FRP1, MEC1, SCKL, SCKL1; ataxia telangiectasia an... 28.9 6.4 hsa:651921 serine/threonine-protein kinase ATR-like 28.9 7.0 tgo:TGME49_042870 hypothetical protein 28.9 7.0 mmu:245000 Atr; ataxia telangiectasia and Rad3 related (EC:2.7... 28.5 8.7 > eco:b2531 iscR, ECK2528, JW2515, yfhP; DNA-binding transcriptional repressor; K13643 Rrf2 family transcriptional regulator, iron-sulfur cluster assembly transcription factor Length=162 Score = 95.1 bits (235), Expect = 7e-20, Method: Compositional matrix adjust. Identities = 51/130 (39%), Positives = 76/130 (58%), Gaps = 2/130 (1%) Query 3 KVSTKGRYALRTMIDLTVNNTGNPIPLKDIATRQNISLKYMEQIISLLIKAKLVKSVRGN 62 ++++KGRYA+ M+D+ +N+ P+PL DI+ RQ ISL Y+EQ+ S L K LV SVRG Sbjct 2 RLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGP 61 Query 63 NGGYLLAKSSMQYTAGDILRAAEGDMAPIACIEKDHCNCNRADYCSVLPFWLGLNKVING 122 GGYLL K + G+++ A D + A + C D C W L+ + G Sbjct 62 GGGYLLGKDASSIAVGEVISAV--DESVDATRCQGKGGCQGGDKCLTHALWRDLSDRLTG 119 Query 123 YLDSVTLSEL 132 +L+++TL EL Sbjct 120 FLNNITLGEL 129 > eco:b4178 nsrR, ECK4174, JW4136, yjeB; nitric oxide-sensitive repressor for NO regulon; K13771 Rrf2 family transcriptional regulator, nitric oxide-sensitive transcriptional repressor Length=141 Score = 49.7 bits (117), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 35/132 (26%), Positives = 66/132 (50%), Gaps = 16/132 (12%) Query 10 YALRTMIDLTVNNTGNPIPLKDIATRQNISLKYMEQIISLLIKAKLVKSVRGNNGGYLLA 69 Y LR +I + G + ++ +S +M +II+ L +A V +VRG NGG L Sbjct 9 YGLRALIYMASLPEGRMTSISEVTDVYGVSRNHMVKIINQLSRAGYVTAVRGKNGGIRLG 68 Query 70 KSSMQYTAGDILRAAEGDMAPIACIEKDHCNCNRADYCSVLP---FWLGLNKVINGY--- 123 K + GD++R ++ P++ + NC+ +++C + P L+K + + Sbjct 69 KPASAIRIGDVVR----ELEPLSLV-----NCS-SEFCHITPACRLKQALSKAVQSFLTE 118 Query 124 LDSVTLSELARQ 135 LD+ TL++L + Sbjct 119 LDNYTLADLVEE 130 > dre:568210 Ral GTPase-activating protein alpha subunit 2-like Length=2050 Score = 32.3 bits (72), Expect = 0.61, Method: Composition-based stats. Identities = 28/104 (26%), Positives = 45/104 (43%), Gaps = 19/104 (18%) Query 13 RTMIDLTVNNTGNPIPLKDIATRQNIS------------LKYMEQIISLLIKAKLVKSVR 60 + +DL ++ P PL TR N S + ++ +++ ++ K V S Sbjct 265 KPQLDLPIHR---PKPLYVPVTRNNESTYCTRDQYLAPRVAFITWLVNFFLEKKYVNSTT 321 Query 61 GN--NGGYLLAKSSMQYTAGDILRAAEGDMAPIACI--EKDHCN 100 N NGG +L K TAG I + D+ P + EK+H N Sbjct 322 SNSKNGGEVLPKLIQTVTAGSISQEKSTDLEPNGPVEQEKNHSN 365 > sce:YML091C RPM2; Protein subunit of mitochondrial RNase P, has roles in nuclear transcription, cytoplasmic and mitochondrial RNA processing, and mitochondrial translation; distributed to mitochondria, cytoplasmic processing bodies, and the nucleus (EC:3.1.26.5); K14533 ribonuclease P protein component, mitochondrial [EC:3.1.26.5] Length=1202 Score = 30.8 bits (68), Expect = 1.6, Method: Composition-based stats. Identities = 11/30 (36%), Positives = 22/30 (73%), Gaps = 0/30 (0%) Query 16 IDLTVNNTGNPIPLKDIATRQNISLKYMEQ 45 +D ++NNT NP+ +++ QN+SL+ ++Q Sbjct 75 LDSSINNTNNPLTHEELLYNQNVSLRSLKQ 104 > ath:AT2G36810 binding Length=1716 Score = 30.8 bits (68), Expect = 1.8, Method: Composition-based stats. Identities = 20/61 (32%), Positives = 35/61 (57%), Gaps = 6/61 (9%) Query 28 PLKD----IATRQNISLKYMEQIISLLIKAKLVKSVRGNNGGYLLAKSSMQYTAGDILRA 83 P++D + +S+ +ME +IS+L ++ LVKS ++ G + SS + DIL+A Sbjct 1213 PMQDAFYAFSQHTELSVLFMEHLISILNRSSLVKS--DSHKGENTSSSSETHVEDDILQA 1270 Query 84 A 84 A Sbjct 1271 A 1271 > tpv:TP04_0848 hypothetical protein; K07179 RIO kinase 2 [EC:2.7.11.1] Length=467 Score = 30.4 bits (67), Expect = 2.6, Method: Composition-based stats. Identities = 26/78 (33%), Positives = 37/78 (47%), Gaps = 4/78 (5%) Query 6 TKGRYALRTMIDLTVNNTGNPIPLKDIATRQNISLKYMEQIISLLIKAKLVKSVRGNNGG 65 T + + T I++ + N IPL I T N+ M ++IS L+KAKL+ G Sbjct 12 TNTEFRVLTAIEIGMRNH-QYIPLSLITTTANLRSVGMSKVISSLLKAKLIVHCGKVYDG 70 Query 66 YLLAKSSMQYTAGDILRA 83 Y L + Y A LRA Sbjct 71 YKLTFLGLDYLA---LRA 85 > tgo:TGME49_020230 leucine rich repeat protein, putative (EC:2.7.11.1 3.1.3.16) Length=1289 Score = 29.6 bits (65), Expect = 4.5, Method: Composition-based stats. Identities = 31/112 (27%), Positives = 51/112 (45%), Gaps = 15/112 (13%) Query 39 SLKYMEQIISLLIKAKLVKSVRGNNGGYLLAKSSMQYTAGDILRAAEGDMAPIACIEKDH 98 S+ Y +Q++ +L +A ++G + LA + TA + R EG +P +E+ + Sbjct 542 SVHYADQLVDILAEA-----LKGTSSLRSLACAGNGMTAVGLRRLCEGLASPTCRLEELN 596 Query 99 CNCNRADYCSVLPF--WLGLNKVI------NGYLDSVTLSELARQAKENNAM 142 CN D VLP L N+ I N L S + +LA +EN + Sbjct 597 VACN--DLQEVLPLAELLLTNRTIRILDVANCMLPSEAVDQLAAALEENTTL 646 > hsa:545 ATR, FRP1, MEC1, SCKL, SCKL1; ataxia telangiectasia and Rad3 related (EC:2.7.11.1); K06640 ataxia telangiectasia and Rad3 related [EC:2.7.11.1] Length=2644 Score = 28.9 bits (63), Expect = 6.4, Method: Composition-based stats. Identities = 12/23 (52%), Positives = 16/23 (69%), Gaps = 0/23 (0%) Query 70 KSSMQYTAGDILRAAEGDMAPIA 92 K ++ T GDI RAA+GD+ P A Sbjct 866 KDTLILTTGDIGRAAKGDLVPFA 888 > hsa:651921 serine/threonine-protein kinase ATR-like Length=2105 Score = 28.9 bits (63), Expect = 7.0, Method: Composition-based stats. Identities = 12/23 (52%), Positives = 16/23 (69%), Gaps = 0/23 (0%) Query 70 KSSMQYTAGDILRAAEGDMAPIA 92 K ++ T GDI RAA+GD+ P A Sbjct 624 KDTLILTTGDIGRAAKGDLVPFA 646 > tgo:TGME49_042870 hypothetical protein Length=361 Score = 28.9 bits (63), Expect = 7.0, Method: Compositional matrix adjust. Identities = 13/43 (30%), Positives = 25/43 (58%), Gaps = 0/43 (0%) Query 20 VNNTGNPIPLKDIATRQNISLKYMEQIISLLIKAKLVKSVRGN 62 + N L+DIA ++ I L Y+++ + L + +L+KS+ N Sbjct 289 LTNAAQVTALRDIAEKEEILLSYIDESLPLAERQRLLKSMSQN 331 > mmu:245000 Atr; ataxia telangiectasia and Rad3 related (EC:2.7.11.1); K06640 ataxia telangiectasia and Rad3 related [EC:2.7.11.1] Length=2641 Score = 28.5 bits (62), Expect = 8.7, Method: Composition-based stats. Identities = 12/23 (52%), Positives = 16/23 (69%), Gaps = 0/23 (0%) Query 70 KSSMQYTAGDILRAAEGDMAPIA 92 K ++ T GDI RAA+GD+ P A Sbjct 866 KDTLILTTGDIGRAAKGDLIPFA 888 Lambda K H 0.316 0.131 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 3321543300 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40