bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_2559_orf1 Length=109 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_036920 hypothetical protein ; K10881 26 proteasome ... 88.2 5e-18 tpv:TP04_0298 hypothetical protein; K10881 26 proteasome compl... 63.2 2e-10 bbo:BBOV_II002950 18.m06244; 26 proteasome complex subunit SEM1 48.1 6e-06 pfa:MAL7P1.117 conserved Plasmodium protein, unknown function;... 37.0 0.018 pfa:PF08_0078 ABC transporter, putative 35.8 0.031 tgo:TGME49_066010 hypothetical protein 32.3 0.38 hsa:65267 WNK3, FLJ30437, FLJ42662, KIAA1566, PRKWNK3; WNK lys... 32.0 0.50 > tgo:TGME49_036920 hypothetical protein ; K10881 26 proteasome complex subunit DSS1 Length=111 Score = 88.2 bits (217), Expect = 5e-18, Method: Compositional matrix adjust. Identities = 47/70 (67%), Positives = 55/70 (78%), Gaps = 2/70 (2%) Query 30 TGAETQEEAFDEPDDELEEFDEIGG-EVPVDAELKQWSEDWDAAGWDDEDPDDEFLEHLQ 88 GAE Q+ FDEPDDELEEFDEIGG + VD E+ QW EDWDAAGWDDED +D+F + LQ Sbjct 28 NGAEEQD-TFDEPDDELEEFDEIGGGDGVVDTEVAQWDEDWDAAGWDDEDVNDDFCKRLQ 86 Query 89 RELEAFKTAY 98 +ELEAFK + Sbjct 87 QELEAFKQRH 96 > tpv:TP04_0298 hypothetical protein; K10881 26 proteasome complex subunit DSS1 Length=109 Score = 63.2 bits (152), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 35/104 (33%), Positives = 53/104 (50%), Gaps = 19/104 (18%) Query 16 AGEEPQRTDSPAQQTGAETQEEAFDEPDDELEEFDEIGGEVPV----------------- 58 EE + + T + + FDEPDDELEEFDEIG + Sbjct 4 TAEETNQVPENKEMTDVSSHFQIFDEPDDELEEFDEIGTILVFLYSFNIIFKYFTENIVT 63 Query 59 --DAELKQWSEDWDAAGWDDEDPDDEFLEHLQRELEAFKTAYAS 100 D E+ W+EDW+ AGWDDED + +F++ + +ELE ++ + + Sbjct 64 VDDPEIADWNEDWETAGWDDEDAESDFVKKILQELENYRKTHNN 107 > bbo:BBOV_II002950 18.m06244; 26 proteasome complex subunit SEM1 Length=85 Score = 48.1 bits (113), Expect = 6e-06, Method: Compositional matrix adjust. Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 1/76 (1%) Query 21 QRTDSPAQQTGAETQEEAFDEPDDELEEFDEIGGEVPVD-AELKQWSEDWDAAGWDDEDP 79 ++T S Q + E F EPD+ELEEFDEI VD E+ W+ DW++AGWDD D Sbjct 6 KQTVSVEQDVDMDKDMEVFIEPDNELEEFDEIDTVATVDDPEILNWNSDWESAGWDDVDV 65 Query 80 DDEFLEHLQRELEAFK 95 D +F++ + +ELE ++ Sbjct 66 DSDFVKRILQELENYR 81 > pfa:MAL7P1.117 conserved Plasmodium protein, unknown function; K10881 26 proteasome complex subunit DSS1 Length=106 Score = 37.0 bits (84), Expect = 0.018, Method: Compositional matrix adjust. Identities = 33/77 (42%), Positives = 46/77 (59%), Gaps = 3/77 (3%) Query 21 QRTDSPAQQTGAETQEEAFDEPDDELEEFDEIGG-EVPVDAELKQWSEDWD-AAGWDDED 78 + D + E FDEPDDELEEF+E+G + VD +L+ W EDW A DD+D Sbjct 20 NKNDGKVNENSGENMY-IFDEPDDELEEFEEMGSVALNVDTDLENWEEDWGAAGWDDDDD 78 Query 79 PDDEFLEHLQRELEAFK 95 DD+F+ ++ EL+ FK Sbjct 79 DDDKFILKVESELQKFK 95 > pfa:PF08_0078 ABC transporter, putative Length=1419 Score = 35.8 bits (81), Expect = 0.031, Method: Composition-based stats. Identities = 18/61 (29%), Positives = 35/61 (57%), Gaps = 8/61 (13%) Query 39 FDEPDDELEEFDEIGGEVPVDAELKQWSEDWDAAGWDDEDPDDEFLEHLQRELEAFKTAY 98 +DE D+ +E+DE +++ ++ E+ D G+D+E +D+ EHL+ L K+ Y Sbjct 174 YDEESDQ-DEYDE-------ESDQDEYDEESDQDGYDEESNEDDLDEHLKERLMKRKSFY 225 Query 99 A 99 + Sbjct 226 S 226 > tgo:TGME49_066010 hypothetical protein Length=5289 Score = 32.3 bits (72), Expect = 0.38, Method: Compositional matrix adjust. Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 0/53 (0%) Query 4 SPYASQMKSQGEAGEEPQRTDSPAQQTGAETQEEAFDEPDDELEEFDEIGGEV 56 SP S + GE GE +RT+S Q+ G + EE + E+ +E+GG+V Sbjct 1969 SPCLSARRCVGELGEMEERTESTKQRRGRGSAEEISPSTGEGSEDREEVGGDV 2021 > hsa:65267 WNK3, FLJ30437, FLJ42662, KIAA1566, PRKWNK3; WNK lysine deficient protein kinase 3 (EC:2.7.11.1); K08867 WNK lysine deficient protein kinase [EC:2.7.11.1] Length=1743 Score = 32.0 bits (71), Expect = 0.50, Method: Compositional matrix adjust. Identities = 18/37 (48%), Positives = 22/37 (59%), Gaps = 3/37 (8%) Query 8 SQMKSQGEAGEEPQRTD---SPAQQTGAETQEEAFDE 41 SQ KS G +PQ T +PAQQTGAE +E D+ Sbjct 509 SQCKSMGNVFPQPQNTTLPLAPAQQTGAECEETEVDQ 545 Lambda K H 0.305 0.125 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2072286120 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40