bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_2760_orf1 Length=180 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_088750 ubiquinol-cytochrome C reductase complex 14 ... 254 1e-67 pfa:PF10_0120 ubiquinol-cytochrome c reductase complex subunit... 229 5e-60 bbo:BBOV_IV009120 23.m06402; hypothetical protein; K00417 ubiq... 219 3e-57 tpv:TP01_0860 ubiquinol-cytochrome C reductase complex 14kD su... 208 9e-54 sce:YDR529C QCR7, COR4, CRO1, UCR7; Qcr7p; K00417 ubiquinol-cy... 55.8 7e-08 ath:AT5G25450 ubiquinol-cytochrome C reductase complex 14 kDa ... 51.6 1e-06 ath:AT4G32470 ubiquinol-cytochrome C reductase complex 14 kDa ... 45.8 9e-05 dre:554154 uqcrb, im:6900881, zgc:109893; ubiquinol-cytochrome... 38.9 0.009 xla:447091 MGC85256 protein; K00417 ubiquinol-cytochrome c red... 36.2 0.068 dre:556134 si:ch211-145c23.4 33.9 0.27 cel:C15F1.2 hypothetical protein 33.9 0.28 mmu:217995 Heatr1, AA517551, B130016L12Rik, BC019693, MGC30806... 33.1 0.48 hsa:55127 HEATR1, BAP28, FLJ10359, MGC72083; HEAT repeat conta... 32.7 0.67 tgo:TGME49_119310 hypothetical protein 32.3 1.0 ath:AT1G74430 MYB95; MYB95 (myb domain protein 95); DNA bindin... 30.4 3.6 ath:AT2G40360 transducin family protein / WD-40 repeat family ... 30.4 3.7 mmu:22371 Vwf, 6820430P06Rik, AI551257, B130011O06Rik, C630030... 30.0 4.1 > tgo:TGME49_088750 ubiquinol-cytochrome C reductase complex 14 kDa protein, putative ; K00417 ubiquinol-cytochrome c reductase subunit 7 [EC:1.10.2.2] Length=234 Score = 254 bits (649), Expect = 1e-67, Method: Compositional matrix adjust. Identities = 120/167 (71%), Positives = 134/167 (80%), Gaps = 0/167 (0%) Query 1 SLVAFTPAAPQPSAVRSFLSELLAPVWFRFFRGPLDRWNQAAIGKYLREQGLMYDDLYSD 60 S V + P+ P VR LS L PVWF+FFRGPLDRWN A + KYLR+ GLMYDDLYSD Sbjct 23 SPVQYVPSPPTKGKVRRALSSALMPVWFKFFRGPLDRWNLAVMAKYLRDHGLMYDDLYSD 82 Query 61 KEPVIERALELLPEDLATARYRRIMRATHLNHVRLYLPPNEQNYDPFIPYLAPYVEEAKF 120 KEPV RALELLP D+ AR+RR+MR T+LNH+RLYLP +EQNYDPFIPY+APYVEEAKF Sbjct 83 KEPVFARALELLPPDIQAARFRRLMRGTYLNHLRLYLPVHEQNYDPFIPYMAPYVEEAKF 142 Query 121 QLQEEEELLGYHMWERRLYSGGCTGLGDFEPGMHFLVSFPNMYGGGG 167 QLQEEEELLGYHMWE YSGG TG GD EPG HFLV+ PN+YG GG Sbjct 143 QLQEEEELLGYHMWEGVWYSGGVTGFGDKEPGEHFLVALPNLYGAGG 189 > pfa:PF10_0120 ubiquinol-cytochrome c reductase complex subunit, putative (EC:1.10.2.2); K00417 ubiquinol-cytochrome c reductase subunit 7 [EC:1.10.2.2] Length=192 Score = 229 bits (583), Expect = 5e-60, Method: Compositional matrix adjust. Identities = 102/164 (62%), Positives = 130/164 (79%), Gaps = 0/164 (0%) Query 3 VAFTPAAPQPSAVRSFLSELLAPVWFRFFRGPLDRWNQAAIGKYLREQGLMYDDLYSDKE 62 + + P + S +R +L+ P +F+F R P +RW A K+LRE GLMYDD+YSDK+ Sbjct 22 LGYEPPKKKRSILRELYHKLIFPYYFKFIRAPYERWQFCATTKFLREHGLMYDDMYSDKD 81 Query 63 PVIERALELLPEDLATARYRRIMRATHLNHVRLYLPPNEQNYDPFIPYLAPYVEEAKFQL 122 PVIERA+ LLP+D+ T RYRR++R TH+N++RL+L P+EQNYDP+IPYLAPY+EEAKFQL Sbjct 82 PVIERAISLLPKDIQTRRYRRMLRGTHINYLRLFLHPSEQNYDPYIPYLAPYIEEAKFQL 141 Query 123 QEEEELLGYHMWERRLYSGGCTGLGDFEPGMHFLVSFPNMYGGG 166 QEEEELLGYH ++RRLYSGG TG GD EPG+HFLVS PN+YG Sbjct 142 QEEEELLGYHPYDRRLYSGGTTGFGDLEPGLHFLVSIPNLYGAA 185 > bbo:BBOV_IV009120 23.m06402; hypothetical protein; K00417 ubiquinol-cytochrome c reductase subunit 7 [EC:1.10.2.2] Length=197 Score = 219 bits (559), Expect = 3e-57, Method: Compositional matrix adjust. Identities = 99/161 (61%), Positives = 123/161 (76%), Gaps = 0/161 (0%) Query 12 PSAVRSFLSELLAPVWFRFFRGPLDRWNQAAIGKYLREQGLMYDDLYSDKEPVIERALEL 71 P + + + P FR F GPL+RW+QA + +YLRE GL+YDDL S++EP++ERALE+ Sbjct 36 PGPLTNIYQTFIGPWVFRMFTGPLERWSQACLTRYLREHGLLYDDLMSEREPIVERALEM 95 Query 72 LPEDLATARYRRIMRATHLNHVRLYLPPNEQNYDPFIPYLAPYVEEAKFQLQEEEELLGY 131 LPEDL TAR+RRI R H++ +R+Y P EQNYDPF+PYLAPY+EEAKFQLQEEEELLGY Sbjct 96 LPEDLKTARFRRIARGMHISTLRMYPPLEEQNYDPFVPYLAPYIEEAKFQLQEEEELLGY 155 Query 132 HMWERRLYSGGCTGLGDFEPGMHFLVSFPNMYGGGGGAHNK 172 H +RR++ GG TG GD EPGMHFL S PN+YG G G K Sbjct 156 HPQDRRVFCGGTTGFGDMEPGMHFLTSLPNLYGAGMGNMKK 196 > tpv:TP01_0860 ubiquinol-cytochrome C reductase complex 14kD subunit (EC:1.10.2.2); K00417 ubiquinol-cytochrome c reductase subunit 7 [EC:1.10.2.2] Length=197 Score = 208 bits (529), Expect = 9e-54, Method: Compositional matrix adjust. Identities = 98/164 (59%), Positives = 121/164 (73%), Gaps = 0/164 (0%) Query 5 FTPAAPQPSAVRSFLSELLAPVWFRFFRGPLDRWNQAAIGKYLREQGLMYDDLYSDKEPV 64 +T P + + +AP +FR GP +RW+ A + +YLRE GL+YDDL ++EP+ Sbjct 29 YTQIQKGPGFFQKVYRKFIAPWYFRAISGPYERWHHACLTRYLREHGLLYDDLMCEREPI 88 Query 65 IERALELLPEDLATARYRRIMRATHLNHVRLYLPPNEQNYDPFIPYLAPYVEEAKFQLQE 124 IERAL +L DLATAR+RRI R ++ +R+Y P EQNYDPFIPYLAP+VEEAKFQLQE Sbjct 89 IERALSILTPDLATARFRRIARGMQISMLRIYPPLEEQNYDPFIPYLAPFVEEAKFQLQE 148 Query 125 EEELLGYHMWERRLYSGGCTGLGDFEPGMHFLVSFPNMYGGGGG 168 EEELLGYH +RRL+ GG TG GD EPGMHFLVSFP +YGGG G Sbjct 149 EEELLGYHPQDRRLFCGGTTGFGDLEPGMHFLVSFPCIYGGGMG 192 > sce:YDR529C QCR7, COR4, CRO1, UCR7; Qcr7p; K00417 ubiquinol-cytochrome c reductase subunit 7 [EC:1.10.2.2] Length=127 Score = 55.8 bits (133), Expect = 7e-08, Method: Compositional matrix adjust. Identities = 41/112 (36%), Positives = 58/112 (51%), Gaps = 12/112 (10%) Query 18 FLSELLAPVWFRFFRGPLDRWNQAAIGKYLREQGLMYDDLYSDKEPVIERALELLPEDLA 77 LS+L PV +F N A K GL +DDL +++ P+++ AL LPED + Sbjct 20 VLSKLCVPVANQFI-------NLAGYKKL----GLKFDDLIAEENPIMQTALRRLPEDES 68 Query 78 TARYRRIMRATHLNHVRLYLPPNE-QNYDPFIPYLAPYVEEAKFQLQEEEEL 128 AR RI+RA LP NE +PYL PY+ EA+ +E++EL Sbjct 69 YARAYRIIRAHQTELTHHLLPRNEWIKAQEDVPYLLPYILEAEAAAKEKDEL 120 > ath:AT5G25450 ubiquinol-cytochrome C reductase complex 14 kDa protein, putative; K00417 ubiquinol-cytochrome c reductase subunit 7 [EC:1.10.2.2] Length=122 Score = 51.6 bits (122), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 43/125 (34%), Positives = 61/125 (48%), Gaps = 13/125 (10%) Query 17 SFLSELLAPVWFRFFRGPLDRWNQAAIGKYLREQGLMYDDLYSDKEPV----IERALELL 72 SFL L+ P + L R + ++ LR GL YDDLY +P+ I+ AL L Sbjct 3 SFLQRLVDPR-----KNFLARMHMKSVSNRLRRYGLRYDDLY---DPLYDLDIKEALNRL 54 Query 73 PEDLATARYRRIMRATHLNHVRLYLPPNEQNYD-PFIPYLAPYVEEAKFQLQEEEELLGY 131 P ++ AR +R+MRA L+ YLP N Q PF YL + K + E E L Sbjct 55 PREIVDARNQRLMRAMDLSMKHEYLPDNLQAVQTPFRSYLQDMLALVKRERAEREALGAL 114 Query 132 HMWER 136 +++R Sbjct 115 PLYQR 119 > ath:AT4G32470 ubiquinol-cytochrome C reductase complex 14 kDa protein, putative; K00417 ubiquinol-cytochrome c reductase subunit 7 [EC:1.10.2.2] Length=122 Score = 45.8 bits (107), Expect = 9e-05, Method: Compositional matrix adjust. Identities = 36/106 (33%), Positives = 53/106 (50%), Gaps = 2/106 (1%) Query 35 LDRWNQAAIGKYLREQGLMYDDLYSDKEPV-IERALELLPEDLATARYRRIMRATHLNHV 93 L R + AI LR GL YDDLY + I+ A+ LP ++ AR +R+ RA L+ Sbjct 16 LARMHMKAISTRLRRYGLRYDDLYDQYYSMDIKEAMNRLPREVVDARNQRLKRAMDLSMK 75 Query 94 RLYLPPNEQNYD-PFIPYLAPYVEEAKFQLQEEEELLGYHMWERRL 138 YLP + Q PF YL + + + +E E L +++R L Sbjct 76 HEYLPKDLQAVQTPFRGYLQDMLALVERESKEREALGALPLYQRTL 121 > dre:554154 uqcrb, im:6900881, zgc:109893; ubiquinol-cytochrome c reductase binding protein (EC:1.10.2.2); K00417 ubiquinol-cytochrome c reductase subunit 7 [EC:1.10.2.2] Length=111 Score = 38.9 bits (89), Expect = 0.009, Method: Compositional matrix adjust. Identities = 27/78 (34%), Positives = 41/78 (52%), Gaps = 2/78 (2%) Query 51 GLMYDDLYSDKEPVIERALELLPEDLATARYRRIMRATHLNHVRLYLPPNE-QNYDPFIP 109 GLM DD + V E A+ LPE L R R+ RA L+ LP ++ ++ + Sbjct 31 GLMRDDTIDEGSDVKE-AVRRLPEPLYNERVFRLKRAMDLSMKHQILPKDQWTKFEQDVK 89 Query 110 YLAPYVEEAKFQLQEEEE 127 YL PY++E + +E+EE Sbjct 90 YLEPYLQEVIRERKEKEE 107 > xla:447091 MGC85256 protein; K00417 ubiquinol-cytochrome c reductase subunit 7 [EC:1.10.2.2] Length=111 Score = 36.2 bits (82), Expect = 0.068, Method: Compositional matrix adjust. Identities = 26/79 (32%), Positives = 44/79 (55%), Gaps = 4/79 (5%) Query 51 GLMYDD-LYSDKEPVIERALELLPEDLATARYRRIMRATHLNHVRLYLPPNE-QNYDPFI 108 GLM DD +Y D + ++ A+ LP + R RI RA ++ + +LP + Y+ + Sbjct 31 GLMRDDTIYEDDD--VKEAIRRLPPRVYDDRLFRIKRALDVSLRQQHLPKQQWTKYEEDV 88 Query 109 PYLAPYVEEAKFQLQEEEE 127 YL PY++E + +E+EE Sbjct 89 RYLEPYLKEVIRERKEKEE 107 > dre:556134 si:ch211-145c23.4 Length=701 Score = 33.9 bits (76), Expect = 0.27, Method: Composition-based stats. Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Query 141 GGCTGLGDFEPGMHFLVSFP-NMYGGGGGAHNKAHLSSLVP 180 GG LGD P +H +VSFP ++ GA + +HL S++P Sbjct 649 GGMETLGDVSPHLHGMVSFPSSVLHSVEGAPSNSHLRSVMP 689 > cel:C15F1.2 hypothetical protein Length=801 Score = 33.9 bits (76), Expect = 0.28, Method: Composition-based stats. Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 7/59 (11%) Query 28 FRFFRGPLDRWNQAAIGKYLREQGLMYDDLYSDKEPVIERALELLPEDLATARYRRIMR 86 F+ +G ++R+ Q GK L DD +K +IE+ALE+L E+ Y+++ R Sbjct 420 FKEVKGLVERFEQRLKGKEL-------DDEQKNKAKLIEKALEMLLENFDDTDYKKVER 471 > mmu:217995 Heatr1, AA517551, B130016L12Rik, BC019693, MGC30806; HEAT repeat containing 1; K14550 U3 small nucleolar RNA-associated protein 10 Length=2143 Score = 33.1 bits (74), Expect = 0.48, Method: Composition-based stats. Identities = 23/79 (29%), Positives = 43/79 (54%), Gaps = 9/79 (11%) Query 61 KEPVIERALELLPEDLATARYRR--------IMRATHLNHVRLYLPP-NEQNYDPFIPYL 111 ++ ++ R L+L+P LA ++++ I R T L ++L QN +PFIP L Sbjct 1633 RKKMVHRFLKLVPVLLAIVQHKKREAEDEQAINRQTALYTLKLLCKNFGAQNREPFIPVL 1692 Query 112 APYVEEAKFQLQEEEELLG 130 + V+ + + +EE+ +LG Sbjct 1693 STAVKLIEPEKKEEKNVLG 1711 > hsa:55127 HEATR1, BAP28, FLJ10359, MGC72083; HEAT repeat containing 1; K14550 U3 small nucleolar RNA-associated protein 10 Length=2144 Score = 32.7 bits (73), Expect = 0.67, Method: Composition-based stats. Identities = 23/79 (29%), Positives = 41/79 (51%), Gaps = 9/79 (11%) Query 61 KEPVIERALELLPEDLATARYRR--------IMRATHLNHVRLYLPP-NEQNYDPFIPYL 111 K+ ++ R L+L+P+ LA + ++ I R T L ++L +N DPF+P L Sbjct 1634 KKTIVTRFLKLVPDLLAIVQRKKKEGEEEQAINRQTALYTLKLLCKNFGAENPDPFVPVL 1693 Query 112 APYVEEAKFQLQEEEELLG 130 V+ + +EE+ +LG Sbjct 1694 NTAVKLIAPERKEEKNVLG 1712 > tgo:TGME49_119310 hypothetical protein Length=3921 Score = 32.3 bits (72), Expect = 1.0, Method: Compositional matrix adjust. Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Query 41 AAIGKYLREQGLMYDDLYSDKEPVIERALELLPEDLATARYRRIMRATHLNHV 93 A YLREQ + +D+ SD RAL+L D +T+ RI+ A H+N Sbjct 1756 ALTADYLREQRELANDILSDIMKAGSRALKLYHGDTSTSGMARIL-AMHINKT 1807 > ath:AT1G74430 MYB95; MYB95 (myb domain protein 95); DNA binding / transcription factor; K09422 myb proto-oncogene protein, plant Length=271 Score = 30.4 bits (67), Expect = 3.6, Method: Compositional matrix adjust. Identities = 12/26 (46%), Positives = 18/26 (69%), Gaps = 0/26 (0%) Query 107 FIPYLAPYVEEAKFQLQEEEELLGYH 132 ++ YL P ++ KF QEEEE++ YH Sbjct 57 WLNYLRPGIKRGKFTPQEEEEIIKYH 82 > ath:AT2G40360 transducin family protein / WD-40 repeat family protein; K14824 ribosome biogenesis protein ERB1 Length=753 Score = 30.4 bits (67), Expect = 3.7, Method: Composition-based stats. Identities = 13/45 (28%), Positives = 29/45 (64%), Gaps = 3/45 (6%) Query 86 RATHLNHV---RLYLPPNEQNYDPFIPYLAPYVEEAKFQLQEEEE 127 ++ HL ++ +L LP ++++Y+P + Y+ E+A ++L EE+ Sbjct 304 KSKHLTYIPPPKLKLPGHDESYNPSLEYIPTEEEKASYELMFEED 348 > mmu:22371 Vwf, 6820430P06Rik, AI551257, B130011O06Rik, C630030D09, F8VWF, VWD; Von Willebrand factor homolog; K03900 von Willebrand factor Length=2813 Score = 30.0 bits (66), Expect = 4.1, Method: Composition-based stats. Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 6/53 (11%) Query 56 DLYSDKEPVIERALELLP---EDLATARYRRIM---RATHLNHVRLYLPPNEQ 102 +L+S+ E ++ L L P E++ + Y IM R THL H+ Y P N + Sbjct 2015 ELHSNMEMAVDGRLVLAPYVGENMEVSIYGAIMYEVRFTHLGHILTYTPQNNE 2067 Lambda K H 0.322 0.141 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 4859948100 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40