bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_2818_orf1 Length=134 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_036920 hypothetical protein ; K10881 26 proteasome ... 82.8 3e-16 tpv:TP04_0298 hypothetical protein; K10881 26 proteasome compl... 70.1 2e-12 bbo:BBOV_II002950 18.m06244; 26 proteasome complex subunit SEM1 39.7 0.002 pfa:MAL7P1.117 conserved Plasmodium protein, unknown function;... 33.9 0.13 pfa:PF08_0078 ABC transporter, putative 33.1 0.27 hsa:65267 WNK3, FLJ30437, FLJ42662, KIAA1566, PRKWNK3; WNK lys... 31.2 1.0 > tgo:TGME49_036920 hypothetical protein ; K10881 26 proteasome complex subunit DSS1 Length=111 Score = 82.8 bits (203), Expect = 3e-16, Method: Compositional matrix adjust. Identities = 48/94 (51%), Positives = 56/94 (59%), Gaps = 25/94 (26%) Query 30 TGAETQEEAFDEPDDELEEFDEIGVACCTKETMSTQMGDTTERTSESSGGEVPVDAELKQ 89 GAE Q+ FDEPDDELEEFDEIG GG+ VD E+ Q Sbjct 28 NGAEEQD-TFDEPDDELEEFDEIG------------------------GGDGVVDTEVAQ 62 Query 90 WSEDWDAAGWDDEDPDDEFLEHLQRELEAFKTAY 123 W EDWDAAGWDDED +D+F + LQ+ELEAFK + Sbjct 63 WDEDWDAAGWDDEDVNDDFCKRLQQELEAFKQRH 96 > tpv:TP04_0298 hypothetical protein; K10881 26 proteasome complex subunit DSS1 Length=109 Score = 70.1 bits (170), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 39/111 (35%), Positives = 58/111 (52%), Gaps = 8/111 (7%) Query 16 AGEEPQRTDSPAQQTGAETQEEAFDEPDDELEEFDEIGVACCTKETMSTQMGDTTERTSE 75 EE + + T + + FDEPDDELEEFDEIG + + TE Sbjct 4 TAEETNQVPENKEMTDVSSHFQIFDEPDDELEEFDEIGTILVFLYSFNIIFKYFTENI-- 61 Query 76 SSGGEVPVD-AELKQWSEDWDAAGWDDEDPDDEFLEHLQRELEAFKTAYAS 125 V VD E+ W+EDW+ AGWDDED + +F++ + +ELE ++ + + Sbjct 62 -----VTVDDPEIADWNEDWETAGWDDEDAESDFVKKILQELENYRKTHNN 107 > bbo:BBOV_II002950 18.m06244; 26 proteasome complex subunit SEM1 Length=85 Score = 39.7 bits (91), Expect = 0.002, Method: Compositional matrix adjust. Identities = 32/100 (32%), Positives = 47/100 (47%), Gaps = 24/100 (24%) Query 21 QRTDSPAQQTGAETQEEAFDEPDDELEEFDEIGVACCTKETMSTQMGDTTERTSESSGGE 80 ++T S Q + E F EPD+ELEEFDEI Sbjct 6 KQTVSVEQDVDMDKDMEVFIEPDNELEEFDEIDTVATVD--------------------- 44 Query 81 VPVDAELKQWSEDWDAAGWDDEDPDDEFLEHLQRELEAFK 120 D E+ W+ DW++AGWDD D D +F++ + +ELE ++ Sbjct 45 ---DPEILNWNSDWESAGWDDVDVDSDFVKRILQELENYR 81 > pfa:MAL7P1.117 conserved Plasmodium protein, unknown function; K10881 26 proteasome complex subunit DSS1 Length=106 Score = 33.9 bits (76), Expect = 0.13, Method: Compositional matrix adjust. Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Query 21 QRTDSPAQQTGAETQEEAFDEPDDELEEFDEIGVACCTKET 61 + D + E FDEPDDELEEF+E+G +T Sbjct 20 NKNDGKVNENSGENMY-IFDEPDDELEEFEEMGSVALNVDT 59 > pfa:PF08_0078 ABC transporter, putative Length=1419 Score = 33.1 bits (74), Expect = 0.27, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 28/50 (56%), Gaps = 0/50 (0%) Query 75 ESSGGEVPVDAELKQWSEDWDAAGWDDEDPDDEFLEHLQRELEAFKTAYA 124 ES E +++ ++ E+ D G+D+E +D+ EHL+ L K+ Y+ Sbjct 177 ESDQDEYDEESDQDEYDEESDQDGYDEESNEDDLDEHLKERLMKRKSFYS 226 > hsa:65267 WNK3, FLJ30437, FLJ42662, KIAA1566, PRKWNK3; WNK lysine deficient protein kinase 3 (EC:2.7.11.1); K08867 WNK lysine deficient protein kinase [EC:2.7.11.1] Length=1743 Score = 31.2 bits (69), Expect = 1.0, Method: Compositional matrix adjust. Identities = 18/37 (48%), Positives = 22/37 (59%), Gaps = 3/37 (8%) Query 8 SQMKSQGEAGEEPQRTD---SPAQQTGAETQEEAFDE 41 SQ KS G +PQ T +PAQQTGAE +E D+ Sbjct 509 SQCKSMGNVFPQPQNTTLPLAPAQQTGAECEETEVDQ 545 Lambda K H 0.305 0.122 0.353 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2231140792 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40