bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_2920_orf1 Length=138 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_078490 hypothetical protein ; K13125 nitric oxide s... 137 1e-32 pfa:PFE0900w conserved protein, unknown function; K13125 nitri... 101 8e-22 bbo:BBOV_II003220 18.m06270; hypothetical protein; K13125 nitr... 87.8 1e-17 cel:R05G6.4 hypothetical protein; K13125 nitric oxide synthase... 86.3 3e-17 mmu:66394 Nosip, 2310061K06Rik, CGI-25, MGC115777; nitric oxid... 83.6 2e-16 hsa:51070 NOSIP; nitric oxide synthase interacting protein; K1... 82.4 4e-16 xla:414557 nosip, MGC78783; nitric oxide synthase interacting ... 79.7 2e-15 ath:AT1G61620 phosphoinositide binding; K13125 nitric oxide sy... 73.6 2e-13 dre:492793 nosip, wu:fb80a11, zgc:101669; nitric oxide synthas... 70.5 1e-12 tpv:TP04_0271 hypothetical protein; K13125 nitric oxide syntha... 59.3 3e-09 hsa:5192 PEX10, MGC1998, NALD, RNF69; peroxisomal biogenesis f... 38.5 0.006 dre:561226 lnx1, MGC152906, fj78f06, lnx, si:dkey-12h2.1, wu:f... 34.3 0.11 mmu:20821 Trim21, Ro52, Ssa1; tripartite motif-containing 21; ... 34.3 0.11 mmu:140887 Lnx2, 9630046H24, AW209022; ligand of numb-protein X 2 34.3 mmu:668173 Pex10, AV128229, Gm142; peroxisomal biogenesis fact... 33.9 0.16 hsa:222484 LNX2, FLJ12933, FLJ23932, FLJ38000, MGC46315, PDZRN... 33.5 0.19 hsa:7706 TRIM25, EFP, RNF147, Z147, ZNF147; tripartite motif c... 33.5 0.21 ath:AT2G26350 PEX10; PEX10; protein binding / zinc ion binding... 33.1 0.25 dre:563047 btr01; bloodthirsty-related gene family, member 1 33.1 mmu:434219 Trim30c, EG434219, Gm5598, Trim30-2; tripartite mot... 32.7 0.31 mmu:100046632 tripartite motif-containing protein 30-like 32.3 0.40 dre:553331 lnx2a, lnx2; ligand of numb-protein X 2a 32.3 0.40 dre:449821 pex10, zgc:103520; peroxisome biogenesis factor 10;... 32.3 0.43 ath:AT1G19310 zinc finger (C3HC4-type RING finger) family protein 32.3 0.51 dre:767728 btr16, MGC154038, si:ch211-247l8.6, zgc:154038; blo... 32.0 0.56 dre:100334710 Mediterranean fever protein-like 32.0 0.57 dre:767681 btr12, MGC153732, zgc:153732; bloodthirsty-related ... 32.0 0.63 pfa:PFF0165c conserved Plasmodium protein, unknown function 32.0 0.65 mmu:217333 Trim47, 2210023F24Rik; tripartite motif-containing ... 31.6 0.69 hsa:91107 TRIM47, GOA, RNF100; tripartite motif containing 47;... 31.6 0.84 ath:AT3G16600 SNF2 domain-containing protein / helicase domain... 31.6 0.85 dre:569616 tripartite motif protein 21-like 31.2 0.92 ath:AT3G07200 zinc finger (C3HC4-type RING finger) family protein 31.2 1.1 ath:AT1G18660 zinc finger (C3HC4-type RING finger) family protein 30.8 1.2 dre:564464 lnx2b, MGC162185, MGC85925, id:ibd3184, lnxL, zgc:8... 30.8 1.2 dre:100151764 btr06, zgc:172052; bloodthirsty-related gene fam... 30.8 1.3 dre:558375 finTRIM family, member 72-like 30.8 1.4 dre:793570 btr07p; bloodthirsty-related gene family, member 7,... 30.4 1.5 ath:AT3G03780 AtMS2; AtMS2; 5-methyltetrahydropteroyltriglutam... 30.4 1.5 mmu:20128 Trim30a, Rpt-1, Rpt1, Trim30; tripartite motif-conta... 30.4 1.7 hsa:29951 PDZRN4, LNX4, SAMCAP3L; PDZ domain containing ring f... 30.4 1.7 ath:AT5G48655 zinc finger (C3HC4-type RING finger) family protein 30.4 1.9 tgo:TGME49_065340 hypothetical protein 30.4 1.9 ath:AT3G20010 SNF2 domain-containing protein / helicase domain... 30.4 1.9 dre:791496 novel protein similar to H.sapiens tripartite motif... 30.0 2.0 dre:797531 finTRIM family, member 72-like 30.0 2.0 dre:100001986 tripartite motif protein TRIM29-like 30.0 2.0 dre:338307 ftr82, MGC153276, id:ibd1340, sb:cb579, si:dkey-252... 30.0 2.0 dre:100149029 PDZ domain containing RING finger 3-like 30.0 2.0 ath:AT5G43530 SNF2 domain-containing protein / helicase domain... 30.0 2.1 > tgo:TGME49_078490 hypothetical protein ; K13125 nitric oxide synthase-interacting protein Length=322 Score = 137 bits (344), Expect = 1e-32, Method: Compositional matrix adjust. Identities = 68/116 (58%), Positives = 82/116 (70%), Gaps = 2/116 (1%) Query 10 ARHSKNATSAPFYSYHERKKIRALGVGTLKGRLDTRACRRFESCWLCLSPARNPLATPQG 69 ARHSKNATSA FYSYHERKK++ VGT + RLDT A RRFE+CWLC A P+ TPQG Sbjct 3 ARHSKNATSAAFYSYHERKKLK--DVGTQRERLDTDALRRFEACWLCNRTALAPVCTPQG 60 Query 70 LIFCKECLFLNFESQKKKIQKETKAWEALQAQKEQEAAAAAEANATAAQRAFLEAE 125 L++CK+CLF NFE QKK++ KE K WEA Q K++ A A+A + FLE E Sbjct 61 LVYCKQCLFFNFEDQKKRMAKELKEWEAQQIAKKEADAVKKMEEASAEKNKFLEEE 116 > pfa:PFE0900w conserved protein, unknown function; K13125 nitric oxide synthase-interacting protein Length=270 Score = 101 bits (251), Expect = 8e-22, Method: Compositional matrix adjust. Identities = 45/88 (51%), Positives = 62/88 (70%), Gaps = 2/88 (2%) Query 9 MARHSKNATSAPFYSYHERKKIRALGVGTLKGRLDTRACRRFESCWLCLSPARNPLATPQ 68 MARHSKN T+ P ++YHERKK++ VGTL+ RL + R+FE CW+CL A NP+++P Sbjct 1 MARHSKNNTANPIFTYHERKKVK--DVGTLRERLGKDSMRKFEQCWICLRTAENPVSSPY 58 Query 69 GLIFCKECLFLNFESQKKKIQKETKAWE 96 G IFCK C+ NF +QKK ++ K +E Sbjct 59 GHIFCKICIINNFLNQKKIYARKKKEYE 86 > bbo:BBOV_II003220 18.m06270; hypothetical protein; K13125 nitric oxide synthase-interacting protein Length=262 Score = 87.8 bits (216), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 41/116 (35%), Positives = 62/116 (53%), Gaps = 2/116 (1%) Query 9 MARHSKNATSAPFYSYHERKKIRALGVGTLKGRLDTRACRRFESCWLCLSPARNPLATPQ 68 M RHSKN T+ P ++YHERK ++ T + RL + RR E CWLCLS A P++T Sbjct 1 MTRHSKNNTANPIFTYHERKNVKDFN--TQRQRLGADSMRRCEQCWLCLSTAEKPVSTSH 58 Query 69 GLIFCKECLFLNFESQKKKIQKETKAWEALQAQKEQEAAAAAEANATAAQRAFLEA 124 G ++CKEC+ FE Q + ++E + + LQ E + +R ++ Sbjct 59 GYVYCKECILKCFEKQMDEYKREHERYVKLQQIDHMRKVEKLEELQESKKRQLIDT 114 > cel:R05G6.4 hypothetical protein; K13125 nitric oxide synthase-interacting protein Length=310 Score = 86.3 bits (212), Expect = 3e-17, Method: Compositional matrix adjust. Identities = 46/107 (42%), Positives = 62/107 (57%), Gaps = 2/107 (1%) Query 9 MARHSKNATSAPFYSYHERKK-IRALGVGTLKGRLDTRACRRFESCWLCLSPARNPLATP 67 M RH KN+T+A Y+YHER++ +A G GTL RL + + F C L L P RNP+ +P Sbjct 1 MTRHGKNSTAASVYTYHERRRDAKASGYGTLHARLGADSIKEFHCCSLTLQPCRNPVISP 60 Query 68 QGLIFCKECLFLNFESQKKKIQKETKAWEALQAQKEQEAAAAAEANA 114 G IF +E + N +QKK K+ K +E Q +E AA AE A Sbjct 61 TGYIFDREAILENILAQKKAYAKKLKEYEK-QVAEESAAAKIAEGQA 106 > mmu:66394 Nosip, 2310061K06Rik, CGI-25, MGC115777; nitric oxide synthase interacting protein; K13125 nitric oxide synthase-interacting protein Length=276 Score = 83.6 bits (205), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 44/122 (36%), Positives = 65/122 (53%), Gaps = 1/122 (0%) Query 9 MARHSKNATSAPFYSYHERKK-IRALGVGTLKGRLDTRACRRFESCWLCLSPARNPLATP 67 M RH KN T+ Y+YHE+KK A G GT RL A + F+ C L L P +P+ TP Sbjct 1 MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTP 60 Query 68 QGLIFCKECLFLNFESQKKKIQKETKAWEALQAQKEQEAAAAAEANATAAQRAFLEAEAS 127 G ++ +E + QK++I ++ KA+E + + +E A A R FLE EA+ Sbjct 61 DGYLYEREAILEYILHQKREIARQVKAYEKQRGARREEQKELQRAAAQDQVRGFLEKEAA 120 Query 128 LT 129 + Sbjct 121 IV 122 > hsa:51070 NOSIP; nitric oxide synthase interacting protein; K13125 nitric oxide synthase-interacting protein Length=301 Score = 82.4 bits (202), Expect = 4e-16, Method: Compositional matrix adjust. Identities = 43/122 (35%), Positives = 65/122 (53%), Gaps = 1/122 (0%) Query 9 MARHSKNATSAPFYSYHERKK-IRALGVGTLKGRLDTRACRRFESCWLCLSPARNPLATP 67 M RH KN T+ Y+YHE+KK A G GT RL A + F+ C L L P +P+ TP Sbjct 1 MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTP 60 Query 68 QGLIFCKECLFLNFESQKKKIQKETKAWEALQAQKEQEAAAAAEANATAAQRAFLEAEAS 127 G ++ +E + QKK+I ++ KA+E + + +E A + R FLE E++ Sbjct 61 DGYLYEREAILEYILHQKKEIARQMKAYEKQRGTRREEQKELQRAASQDHVRGFLEKESA 120 Query 128 LT 129 + Sbjct 121 IV 122 > xla:414557 nosip, MGC78783; nitric oxide synthase interacting protein; K13125 nitric oxide synthase-interacting protein Length=298 Score = 79.7 bits (195), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 43/122 (35%), Positives = 66/122 (54%), Gaps = 1/122 (0%) Query 9 MARHSKNATSAPFYSYHERKK-IRALGVGTLKGRLDTRACRRFESCWLCLSPARNPLATP 67 M RH KN T+ Y+Y+E+KK A G GT RL A + F+ C L L P ++P+ T Sbjct 1 MTRHGKNCTAGAVYTYYEKKKDTVASGYGTQTVRLSKDAVKDFDCCCLSLQPCKDPVVTS 60 Query 68 QGLIFCKECLFLNFESQKKKIQKETKAWEALQAQKEQEAAAAAEANATAAQRAFLEAEAS 127 G I+ KE + QKK+I ++ KA+E + K+ E +A + +AFL+ E + Sbjct 61 DGYIYEKESILEYILHQKKEIARQMKAYEKQKNSKKAEMEELNKAAKESKMKAFLDKEMT 120 Query 128 LT 129 + Sbjct 121 IV 122 > ath:AT1G61620 phosphoinositide binding; K13125 nitric oxide synthase-interacting protein Length=310 Score = 73.6 bits (179), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 36/95 (37%), Positives = 56/95 (58%), Gaps = 3/95 (3%) Query 11 RHSKNATSAPFYSYHERKKIRALGVGTLKGRLDTRACRRFESCWLCLSPARNPLATPQGL 70 RHSKN +++Y E+KK LG GT + RL + + F++C LCL P +P+ +G Sbjct 4 RHSKNNNDLAYFTYDEKKK---LGYGTQRERLGRDSIKPFDACSLCLKPFIDPMCCHKGH 60 Query 71 IFCKECLFLNFESQKKKIQKETKAWEALQAQKEQE 105 +FC+EC+ F +QKK IQ+ A + + Q + E Sbjct 61 VFCRECILECFLAQKKDIQRRLAAHSSQKKQDKDE 95 > dre:492793 nosip, wu:fb80a11, zgc:101669; nitric oxide synthase interacting protein; K13125 nitric oxide synthase-interacting protein Length=304 Score = 70.5 bits (171), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 37/89 (41%), Positives = 49/89 (55%), Gaps = 1/89 (1%) Query 9 MARHSKNATSAPFYSYHE-RKKIRALGVGTLKGRLDTRACRRFESCWLCLSPARNPLATP 67 M RH KN T+ Y+YHE RK A G GT RL A + F+ C L L P R+P+ T Sbjct 1 MTRHGKNCTAGAVYTYHEKRKDTAASGYGTQSVRLGKDAIKDFDCCSLSLQPCRDPVLTE 60 Query 68 QGLIFCKECLFLNFESQKKKIQKETKAWE 96 G ++ KE + QK +I K+ KA+E Sbjct 61 DGYLYEKEAILQYILHQKTEIAKKMKAYE 89 > tpv:TP04_0271 hypothetical protein; K13125 nitric oxide synthase-interacting protein Length=241 Score = 59.3 bits (142), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 0/50 (0%) Query 48 RRFESCWLCLSPARNPLATPQGLIFCKECLFLNFESQKKKIQKETKAWEA 97 R+FE CWLCL+ A P+ TP G I+CKEC+ ++ Q +K +K WE+ Sbjct 2 RKFEQCWLCLATAVKPVTTPSGYIYCKECILMSLAKQMEKNKKLLSQWES 51 > hsa:5192 PEX10, MGC1998, NALD, RNF69; peroxisomal biogenesis factor 10; K13346 peroxin-10 Length=326 Score = 38.5 bits (88), Expect = 0.006, Method: Compositional matrix adjust. Identities = 23/71 (32%), Positives = 34/71 (47%), Gaps = 5/71 (7%) Query 12 HSKNATSAPFYSYHERKKIR-----ALGVGTLKGRLDTRACRRFESCWLCLSPARNPLAT 66 H + Y + +R++ R G+ + L+ RA R C LCL R+P AT Sbjct 227 HLVLSMGLQLYGFRQRQRARKEWRLHRGLSHRRASLEERAVSRNPLCTLCLEERRHPTAT 286 Query 67 PQGLIFCKECL 77 P G +FC EC+ Sbjct 287 PCGHLFCWECI 297 > dre:561226 lnx1, MGC152906, fj78f06, lnx, si:dkey-12h2.1, wu:fj78f06, zgc:152906; ligand of numb-protein X 1 (EC:6.3.2.19); K10692 E3 ubiquitin-protein ligase LNX1 [EC:6.3.2.19] Length=754 Score = 34.3 bits (77), Expect = 0.11, Method: Composition-based stats. Identities = 13/25 (52%), Positives = 16/25 (64%), Gaps = 0/25 (0%) Query 53 CWLCLSPARNPLATPQGLIFCKECL 77 C +CL P PL TP G +C+ECL Sbjct 46 CHICLQPLIRPLDTPCGHTYCQECL 70 > mmu:20821 Trim21, Ro52, Ssa1; tripartite motif-containing 21; K10651 tripartite motif-containing protein 21 Length=462 Score = 34.3 bits (77), Expect = 0.11, Method: Compositional matrix adjust. Identities = 12/27 (44%), Positives = 17/27 (62%), Gaps = 0/27 (0%) Query 52 SCWLCLSPARNPLATPQGLIFCKECLF 78 +C +CL P P++ G FCKEC+F Sbjct 11 TCSICLDPMVEPMSIECGHCFCKECIF 37 > mmu:140887 Lnx2, 9630046H24, AW209022; ligand of numb-protein X 2 Length=687 Score = 34.3 bits (77), Expect = 0.12, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query 53 CWLCLSPARNPLATPQGLIFCKECLFLNFESQK 85 C +CL P PL TP G FC +CL NF +K Sbjct 51 CHICLQPLLQPLDTPCGHTFCHKCL-RNFLQEK 82 > mmu:668173 Pex10, AV128229, Gm142; peroxisomal biogenesis factor 10; K13346 peroxin-10 Length=324 Score = 33.9 bits (76), Expect = 0.16, Method: Compositional matrix adjust. Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 0/36 (0%) Query 42 LDTRACRRFESCWLCLSPARNPLATPQGLIFCKECL 77 L+ RA R C LCL R+ ATP G +FC EC+ Sbjct 260 LEDRAVCRTPLCTLCLEERRHSTATPCGHLFCWECI 295 > hsa:222484 LNX2, FLJ12933, FLJ23932, FLJ38000, MGC46315, PDZRN1; ligand of numb-protein X 2 Length=690 Score = 33.5 bits (75), Expect = 0.19, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query 53 CWLCLSPARNPLATPQGLIFCKECLFLNFESQK 85 C +CL P PL TP G FC +CL NF +K Sbjct 50 CHICLQPLLQPLDTPCGHTFCYKCL-RNFLQEK 81 > hsa:7706 TRIM25, EFP, RNF147, Z147, ZNF147; tripartite motif containing 25 (EC:6.3.2.19); K10652 tripartite motif-containing protein 25 Length=630 Score = 33.5 bits (75), Expect = 0.21, Method: Compositional matrix adjust. Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 0/26 (0%) Query 52 SCWLCLSPARNPLATPQGLIFCKECL 77 SC +CL P + P+ TP G FC CL Sbjct 12 SCSICLEPFKEPVTTPCGHNFCGSCL 37 > ath:AT2G26350 PEX10; PEX10; protein binding / zinc ion binding; K13346 peroxin-10 Length=381 Score = 33.1 bits (74), Expect = 0.25, Method: Compositional matrix adjust. Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 0/36 (0%) Query 43 DTRACRRFESCWLCLSPARNPLATPQGLIFCKECLF 78 D+ + C LCLS ++P ATP G +FC C+ Sbjct 317 DSTSTEAVGKCTLCLSTRQHPTATPCGHVFCWSCIM 352 > dre:563047 btr01; bloodthirsty-related gene family, member 1 Length=582 Score = 33.1 bits (74), Expect = 0.26, Method: Compositional matrix adjust. Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 0/35 (0%) Query 52 SCWLCLSPARNPLATPQGLIFCKECLFLNFESQKK 86 +C +CL NP++TP G FC C+ +E Q K Sbjct 14 TCSICLDIFTNPVSTPCGHSFCSSCISSYWEGQGK 48 > mmu:434219 Trim30c, EG434219, Gm5598, Trim30-2; tripartite motif-containing 30C Length=513 Score = 32.7 bits (73), Expect = 0.31, Method: Composition-based stats. Identities = 12/35 (34%), Positives = 22/35 (62%), Gaps = 0/35 (0%) Query 52 SCWLCLSPARNPLATPQGLIFCKECLFLNFESQKK 86 +C +CL + P++T G FC+ C+ LN+ S ++ Sbjct 15 TCPICLELLKEPVSTDCGHSFCQTCIILNYVSNRR 49 > mmu:100046632 tripartite motif-containing protein 30-like Length=315 Score = 32.3 bits (72), Expect = 0.40, Method: Compositional matrix adjust. Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 0/36 (0%) Query 52 SCWLCLSPARNPLATPQGLIFCKECLFLNFESQKKK 87 +C +CL + P++T FC+ C+ LN+ES K + Sbjct 14 TCPICLELLKEPVSTDCDHSFCRACITLNYESSKSR 49 > dre:553331 lnx2a, lnx2; ligand of numb-protein X 2a Length=737 Score = 32.3 bits (72), Expect = 0.40, Method: Composition-based stats. Identities = 13/25 (52%), Positives = 14/25 (56%), Gaps = 0/25 (0%) Query 53 CWLCLSPARNPLATPQGLIFCKECL 77 C +CL P PL TP G FC CL Sbjct 49 CHICLQPLVQPLDTPCGHTFCARCL 73 > dre:449821 pex10, zgc:103520; peroxisome biogenesis factor 10; K13346 peroxin-10 Length=318 Score = 32.3 bits (72), Expect = 0.43, Method: Compositional matrix adjust. Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 4/53 (7%) Query 25 HERKKIRALGVGTLKGRLDTRACRRFESCWLCLSPARNPLATPQGLIFCKECL 77 HE K+ R L L +++ R C LCL RN +TP G +FC EC+ Sbjct 241 HEWKQHRNL----LPSHQVSQSSSRTSRCILCLEERRNTTSTPCGHLFCWECI 289 > ath:AT1G19310 zinc finger (C3HC4-type RING finger) family protein Length=226 Score = 32.3 bits (72), Expect = 0.51, Method: Compositional matrix adjust. Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Query 53 CWLCLSPARNPLATPQGLIFCKECLF--LNFESQKKK 87 C +CL A++P+ T G +FC CL+ L+ SQ K Sbjct 23 CNICLDLAQDPIVTLCGHLFCWPCLYKWLHLHSQSKD 59 > dre:767728 btr16, MGC154038, si:ch211-247l8.6, zgc:154038; bloodthirsty-related gene family, member 16 Length=395 Score = 32.0 bits (71), Expect = 0.56, Method: Compositional matrix adjust. Identities = 12/25 (48%), Positives = 16/25 (64%), Gaps = 0/25 (0%) Query 53 CWLCLSPARNPLATPQGLIFCKECL 77 C +CL +P++TP G FCK CL Sbjct 19 CSICLDAFTDPVSTPCGHNFCKSCL 43 > dre:100334710 Mediterranean fever protein-like Length=542 Score = 32.0 bits (71), Expect = 0.57, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 22/33 (66%), Gaps = 0/33 (0%) Query 53 CWLCLSPARNPLATPQGLIFCKECLFLNFESQK 85 C +C+ +P++TP G IFCK CL +E+++ Sbjct 36 CSICVKVFTDPVSTPCGHIFCKSCLNKCWENKQ 68 > dre:767681 btr12, MGC153732, zgc:153732; bloodthirsty-related gene family, member 12 Length=562 Score = 32.0 bits (71), Expect = 0.63, Method: Compositional matrix adjust. Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 0/26 (0%) Query 52 SCWLCLSPARNPLATPQGLIFCKECL 77 SC +CL P++TP G FCK CL Sbjct 17 SCSICLEVFVEPVSTPCGHTFCKACL 42 > pfa:PFF0165c conserved Plasmodium protein, unknown function Length=1103 Score = 32.0 bits (71), Expect = 0.65, Method: Composition-based stats. Identities = 13/40 (32%), Positives = 22/40 (55%), Gaps = 0/40 (0%) Query 48 RRFESCWLCLSPARNPLATPQGLIFCKECLFLNFESQKKK 87 RR C +C+ RN + G I+C C+F N +++ +K Sbjct 1045 RRRLICSVCMENFRNYIIIKCGHIYCNNCIFNNLKTRNRK 1084 > mmu:217333 Trim47, 2210023F24Rik; tripartite motif-containing 47; K12023 tripartite motif-containing protein 47 Length=642 Score = 31.6 bits (70), Expect = 0.69, Method: Compositional matrix adjust. Identities = 13/26 (50%), Positives = 15/26 (57%), Gaps = 0/26 (0%) Query 52 SCWLCLSPARNPLATPQGLIFCKECL 77 SC +CL P R P+ P G FC CL Sbjct 8 SCPICLEPLREPVTLPCGHNFCLACL 33 > hsa:91107 TRIM47, GOA, RNF100; tripartite motif containing 47; K12023 tripartite motif-containing protein 47 Length=638 Score = 31.6 bits (70), Expect = 0.84, Method: Compositional matrix adjust. Identities = 13/26 (50%), Positives = 15/26 (57%), Gaps = 0/26 (0%) Query 52 SCWLCLSPARNPLATPQGLIFCKECL 77 SC +CL P R P+ P G FC CL Sbjct 8 SCPICLEPLREPVTLPCGHNFCLACL 33 > ath:AT3G16600 SNF2 domain-containing protein / helicase domain-containing protein / RING finger domain-containing protein Length=638 Score = 31.6 bits (70), Expect = 0.85, Method: Composition-based stats. Identities = 11/29 (37%), Positives = 19/29 (65%), Gaps = 0/29 (0%) Query 52 SCWLCLSPARNPLATPQGLIFCKECLFLN 80 +C +C P ++P+ T G +FC EC+ +N Sbjct 394 TCSVCSDPPKDPVVTLCGHVFCYECVSVN 422 > dre:569616 tripartite motif protein 21-like Length=475 Score = 31.2 bits (69), Expect = 0.92, Method: Compositional matrix adjust. Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Query 52 SCWLCLSPARNPLATPQGLIFCKECL--FLNFESQKK 86 SC +C+ R+P+ P G +C EC+ F +SQ+K Sbjct 16 SCPICMDLLRDPVTIPCGHNYCMECIKSFWEQKSQRK 52 > ath:AT3G07200 zinc finger (C3HC4-type RING finger) family protein Length=182 Score = 31.2 bits (69), Expect = 1.1, Method: Compositional matrix adjust. Identities = 12/26 (46%), Positives = 17/26 (65%), Gaps = 0/26 (0%) Query 52 SCWLCLSPARNPLATPQGLIFCKECL 77 SC +CL P ++T G IFCK+C+ Sbjct 126 SCPICLCPFTQEVSTKCGHIFCKKCI 151 > ath:AT1G18660 zinc finger (C3HC4-type RING finger) family protein Length=486 Score = 30.8 bits (68), Expect = 1.2, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 0/34 (0%) Query 53 CWLCLSPARNPLATPQGLIFCKECLFLNFESQKK 86 C +CL P TP G FC+ CLF + + K Sbjct 196 CTVCLKLLYEPATTPCGHTFCRSCLFQSMDRGNK 229 > dre:564464 lnx2b, MGC162185, MGC85925, id:ibd3184, lnxL, zgc:85925; ligand of numb-protein X 2b Length=678 Score = 30.8 bits (68), Expect = 1.2, Method: Composition-based stats. Identities = 11/25 (44%), Positives = 15/25 (60%), Gaps = 0/25 (0%) Query 53 CWLCLSPARNPLATPQGLIFCKECL 77 C +CL P P+ TP G +C +CL Sbjct 46 CHICLQPLLQPMDTPCGHTYCFQCL 70 > dre:100151764 btr06, zgc:172052; bloodthirsty-related gene family, member 6 Length=556 Score = 30.8 bits (68), Expect = 1.3, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 0/33 (0%) Query 53 CWLCLSPARNPLATPQGLIFCKECLFLNFESQK 85 C +CL +P++TP G FCK CL ++E+ + Sbjct 39 CSVCLDVFTDPVSTPCGHNFCKSCLNTSWENSQ 71 > dre:558375 finTRIM family, member 72-like Length=537 Score = 30.8 bits (68), Expect = 1.4, Method: Compositional matrix adjust. Identities = 10/26 (38%), Positives = 15/26 (57%), Gaps = 0/26 (0%) Query 52 SCWLCLSPARNPLATPQGLIFCKECL 77 SC +CL P + P+ P G +C C+ Sbjct 14 SCSVCLDPLKQPVTIPCGHSYCMSCI 39 > dre:793570 btr07p; bloodthirsty-related gene family, member 7, pseudogene Length=552 Score = 30.4 bits (67), Expect = 1.5, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 0/33 (0%) Query 53 CWLCLSPARNPLATPQGLIFCKECLFLNFESQK 85 C +CL +P++TP G FCK CL ++E+ + Sbjct 35 CSVCLDVFTDPVSTPCGHHFCKSCLNKSWENSQ 67 > ath:AT3G03780 AtMS2; AtMS2; 5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase/ methionine synthase (EC:2.1.1.14); K00549 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase [EC:2.1.1.14] Length=765 Score = 30.4 bits (67), Expect = 1.5, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 0/52 (0%) Query 85 KKKIQKETKAWEALQAQKEQEAAAAAEANATAAQRAFLEAEASLTLETSAAP 136 + K+ E K+W A AQK E A A+A A +F A A ++P Sbjct 340 ETKLDAEIKSWLAFAAQKVVEVDALAKALAGQTNESFFTANADALSSRRSSP 391 > mmu:20128 Trim30a, Rpt-1, Rpt1, Trim30; tripartite motif-containing 30A Length=496 Score = 30.4 bits (67), Expect = 1.7, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 20/34 (58%), Gaps = 0/34 (0%) Query 52 SCWLCLSPARNPLATPQGLIFCKECLFLNFESQK 85 +C +CL + P++ FC+ C+ LN+ES + Sbjct 14 TCPICLELLKEPVSADCNHSFCRACITLNYESNR 47 > hsa:29951 PDZRN4, LNX4, SAMCAP3L; PDZ domain containing ring finger 4 Length=1036 Score = 30.4 bits (67), Expect = 1.7, Method: Compositional matrix adjust. Identities = 12/26 (46%), Positives = 13/26 (50%), Gaps = 0/26 (0%) Query 53 CWLCLSPARNPLATPQGLIFCKECLF 78 C LC PL TP G +FC CL Sbjct 18 CKLCGQVLEEPLCTPCGHVFCASCLL 43 > ath:AT5G48655 zinc finger (C3HC4-type RING finger) family protein Length=203 Score = 30.4 bits (67), Expect = 1.9, Method: Compositional matrix adjust. Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 0/35 (0%) Query 52 SCWLCLSPARNPLATPQGLIFCKECLFLNFESQKK 86 +C +C+ P ++T G IFCK C+ + Q K Sbjct 147 TCPICMCPFTEEMSTKCGHIFCKGCIKMAISRQGK 181 > tgo:TGME49_065340 hypothetical protein Length=225 Score = 30.4 bits (67), Expect = 1.9, Method: Compositional matrix adjust. Identities = 22/59 (37%), Positives = 27/59 (45%), Gaps = 6/59 (10%) Query 23 SYHERKKIRALGVGTLKG-----RLDTRACRRFESCW-LCLSPARNPLATPQGLIFCKE 75 S +E +KI ++GV G LDT+AC SCW C NP A G F E Sbjct 116 SGNEIRKICSVGVSNPGGYPLCEELDTQACGHGCSCWSTCTDHNCNPDALSAGFFFVTE 174 > ath:AT3G20010 SNF2 domain-containing protein / helicase domain-containing protein / RING finger domain-containing protein Length=1047 Score = 30.4 bits (67), Expect = 1.9, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 23/54 (42%), Gaps = 4/54 (7%) Query 29 KIRALGVGTLKGRLDTRACRRFES----CWLCLSPARNPLATPQGLIFCKECLF 78 K+ V L +R R ES C+ C P P+ T G IFC EC+ Sbjct 723 KVSEAAVRRLPREARSRLINRLESSSAICYECNEPPEKPVVTLCGHIFCYECVL 776 > dre:791496 novel protein similar to H.sapiens tripartite motif-containing Length=479 Score = 30.0 bits (66), Expect = 2.0, Method: Compositional matrix adjust. Identities = 23/83 (27%), Positives = 37/83 (44%), Gaps = 17/83 (20%) Query 52 SCWLCLSPARNPLATPQGLIFCKECL--FLNFESQKKK---------------IQKETKA 94 SC +CL ++P++ P G +C C+ N E QK+ + K T Sbjct 13 SCSVCLDLLKDPVSIPCGHSYCMSCITDCWNQEDQKRVYSCPQCRQTFSPRPALAKNTML 72 Query 95 WEALQAQKEQEAAAAAEANATAA 117 E L+ Q++ + AA A + AA Sbjct 73 AEVLEKQQKSKLQAAGPAQSPAA 95 > dre:797531 finTRIM family, member 72-like Length=553 Score = 30.0 bits (66), Expect = 2.0, Method: Compositional matrix adjust. Identities = 10/26 (38%), Positives = 15/26 (57%), Gaps = 0/26 (0%) Query 52 SCWLCLSPARNPLATPQGLIFCKECL 77 SC +CL P + P+ P G +C C+ Sbjct 14 SCPVCLDPLKEPVTIPCGHSYCMSCI 39 > dre:100001986 tripartite motif protein TRIM29-like Length=221 Score = 30.0 bits (66), Expect = 2.0, Method: Compositional matrix adjust. Identities = 12/25 (48%), Positives = 16/25 (64%), Gaps = 0/25 (0%) Query 53 CWLCLSPARNPLATPQGLIFCKECL 77 C +CL +P++TP G FCK CL Sbjct 14 CSICLEVFTDPVSTPCGHNFCKSCL 38 > dre:338307 ftr82, MGC153276, id:ibd1340, sb:cb579, si:dkey-252h13.6, wu:fb99c05, zgc:153276; finTRIM family, member 82; K12023 tripartite motif-containing protein 47 Length=573 Score = 30.0 bits (66), Expect = 2.0, Method: Compositional matrix adjust. Identities = 11/28 (39%), Positives = 17/28 (60%), Gaps = 0/28 (0%) Query 50 FESCWLCLSPARNPLATPQGLIFCKECL 77 + +C LC R+P+A P G FC +C+ Sbjct 9 YFNCPLCTELLRDPVAIPCGHSFCMDCI 36 > dre:100149029 PDZ domain containing RING finger 3-like Length=1033 Score = 30.0 bits (66), Expect = 2.0, Method: Compositional matrix adjust. Identities = 12/24 (50%), Positives = 14/24 (58%), Gaps = 0/24 (0%) Query 53 CWLCLSPARNPLATPQGLIFCKEC 76 C LC +PLATP G +FC C Sbjct 18 CKLCGKVLEDPLATPCGHVFCAAC 41 > ath:AT5G43530 SNF2 domain-containing protein / helicase domain-containing protein / RING finger domain-containing protein Length=1277 Score = 30.0 bits (66), Expect = 2.1, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 0/33 (0%) Query 51 ESCWLCLSPARNPLATPQGLIFCKECLFLNFES 83 + C +CL A +P+ TP C+ECL ++ S Sbjct 1038 KECPICLESADDPVLTPCAHRMCRECLLTSWRS 1070 Lambda K H 0.316 0.124 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2421919804 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40