bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_3156_orf1 Length=129 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_034360 DNA topoisomerase I, putative ; K03163 DNA t... 60.8 1e-09 dre:334557 fl27b11, wu:fl27b11; zgc:173742 54.7 8e-08 xla:734592 top1.2, MGC115546; topoisomerase (DNA) I, gene 2 53.5 dre:553496 top1l, wu:fc66a02, zgc:136349; topoisomerase (DNA) ... 53.1 2e-07 mmu:21969 Top1, AI467334, D130064I21Rik, Top-1; topoisomerase ... 52.4 4e-07 hsa:7150 TOP1, TOPI; topoisomerase (DNA) I (EC:5.99.1.2); K031... 52.0 4e-07 hsa:116447 TOP1MT; topoisomerase (DNA) I, mitochondrial (EC:5.... 50.4 1e-06 ath:AT5G55300 TOP1ALPHA (DNA TOPOISOMERASE I ALPHA); DNA topoi... 49.3 3e-06 mmu:72960 Top1mt, 2900052H09Rik; DNA topoisomerase 1, mitochon... 48.5 6e-06 bbo:BBOV_II007450 18.m06618; DNA topoisomerase (EC:5.99.1.2); ... 47.4 1e-05 pfa:PFE0520c topoisomerase I (EC:5.99.1.2); K03163 DNA topoiso... 47.0 1e-05 ath:AT5G55310 TOP1BETA (DNA TOPOISOMERASE 1 BETA); DNA topoiso... 46.2 2e-05 tpv:TP02_0198 DNA topoisomerase I; K03163 DNA topoisomerase I ... 45.4 4e-05 xla:399263 top1.1, top1; topoisomerase (DNA) I, gene 1 (EC:5.9... 44.7 7e-05 cel:M01E5.5 top-1; TOPoisomerase family member (top-1); K03163... 44.3 9e-05 dre:327179 top1, fd15f07, wu:fd15f07; topoisomerase (DNA) I 44.3 9e-05 cpv:cgd7_3350 eukaryotic DNA topoisomerase I ; K03163 DNA topo... 44.3 9e-05 sce:YOL006C TOP1, MAK1, MAK17; Top1p (EC:5.99.1.2); K03163 DNA... 43.1 2e-04 dre:415098 top1mt; mitochondrial topoisomerase I (EC:5.99.1.2) 40.4 0.001 bbo:BBOV_II003820 18.m06321; sf-assemblin/beta giardin family ... 29.3 3.5 > tgo:TGME49_034360 DNA topoisomerase I, putative ; K03163 DNA topoisomerase I [EC:5.99.1.2] Length=953 Score = 60.8 bits (146), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 27/36 (75%), Positives = 29/36 (80%), Gaps = 0/36 (0%) Query 2 TNHLKQLMPGLSAKMFRTYNASITLQQELQKLQPTL 37 NHL+Q MPGLSAK+FRTYNASITLQ EL KL L Sbjct 679 NNHLRQFMPGLSAKVFRTYNASITLQNELFKLDEAL 714 > dre:334557 fl27b11, wu:fl27b11; zgc:173742 Length=609 Score = 54.7 bits (130), Expect = 8e-08, Method: Compositional matrix adjust. Identities = 23/30 (76%), Positives = 28/30 (93%), Gaps = 0/30 (0%) Query 4 HLKQLMPGLSAKMFRTYNASITLQQELQKL 33 HL LMPGL+AK+FRTYNASITLQQ+L++L Sbjct 420 HLSSLMPGLTAKVFRTYNASITLQQQLKEL 449 > xla:734592 top1.2, MGC115546; topoisomerase (DNA) I, gene 2 Length=503 Score = 53.5 bits (127), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 23/30 (76%), Positives = 28/30 (93%), Gaps = 0/30 (0%) Query 4 HLKQLMPGLSAKMFRTYNASITLQQELQKL 33 HL+ LM GL+AK+FRTYNASITLQQ+LQ+L Sbjct 314 HLQSLMEGLTAKVFRTYNASITLQQQLQEL 343 > dre:553496 top1l, wu:fc66a02, zgc:136349; topoisomerase (DNA) I, like; K03163 DNA topoisomerase I [EC:5.99.1.2] Length=758 Score = 53.1 bits (126), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%) Query 4 HLKQLMPGLSAKMFRTYNASITLQQELQKL 33 HL++LM GL+AK+FRTYNASITLQQ+L +L Sbjct 569 HLQELMDGLTAKVFRTYNASITLQQQLNEL 598 > mmu:21969 Top1, AI467334, D130064I21Rik, Top-1; topoisomerase (DNA) I (EC:5.99.1.2); K03163 DNA topoisomerase I [EC:5.99.1.2] Length=767 Score = 52.4 bits (124), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%) Query 4 HLKQLMPGLSAKMFRTYNASITLQQELQKL 33 HL+ LM GL+AK+FRTYNASITLQQ+L++L Sbjct 578 HLQDLMEGLTAKVFRTYNASITLQQQLKEL 607 > hsa:7150 TOP1, TOPI; topoisomerase (DNA) I (EC:5.99.1.2); K03163 DNA topoisomerase I [EC:5.99.1.2] Length=765 Score = 52.0 bits (123), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%) Query 4 HLKQLMPGLSAKMFRTYNASITLQQELQKL 33 HL+ LM GL+AK+FRTYNASITLQQ+L++L Sbjct 576 HLQDLMEGLTAKVFRTYNASITLQQQLKEL 605 > hsa:116447 TOP1MT; topoisomerase (DNA) I, mitochondrial (EC:5.99.1.2); K03163 DNA topoisomerase I [EC:5.99.1.2] Length=601 Score = 50.4 bits (119), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 21/30 (70%), Positives = 28/30 (93%), Gaps = 0/30 (0%) Query 4 HLKQLMPGLSAKMFRTYNASITLQQELQKL 33 HL++LM GL+AK+FRTYNASITLQ++L+ L Sbjct 412 HLQELMDGLTAKVFRTYNASITLQEQLRAL 441 > ath:AT5G55300 TOP1ALPHA (DNA TOPOISOMERASE I ALPHA); DNA topoisomerase type I; K03163 DNA topoisomerase I [EC:5.99.1.2] Length=916 Score = 49.3 bits (116), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 20/27 (74%), Positives = 25/27 (92%), Gaps = 0/27 (0%) Query 4 HLKQLMPGLSAKMFRTYNASITLQQEL 30 HLK+L+PGL+AK+FRTYNASITL + L Sbjct 722 HLKELVPGLTAKVFRTYNASITLDEML 748 > mmu:72960 Top1mt, 2900052H09Rik; DNA topoisomerase 1, mitochondrial (EC:5.99.1.2); K03163 DNA topoisomerase I [EC:5.99.1.2] Length=593 Score = 48.5 bits (114), Expect = 6e-06, Method: Compositional matrix adjust. Identities = 20/30 (66%), Positives = 27/30 (90%), Gaps = 0/30 (0%) Query 4 HLKQLMPGLSAKMFRTYNASITLQQELQKL 33 HL+ LM GL+AK+FRTYNAS+TLQ++L+ L Sbjct 405 HLQDLMEGLTAKVFRTYNASVTLQEQLRVL 434 > bbo:BBOV_II007450 18.m06618; DNA topoisomerase (EC:5.99.1.2); K03163 DNA topoisomerase I [EC:5.99.1.2] Length=701 Score = 47.4 bits (111), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 20/33 (60%), Positives = 29/33 (87%), Gaps = 0/33 (0%) Query 2 TNHLKQLMPGLSAKMFRTYNASITLQQELQKLQ 34 ++LK LM GL+AK+FRTYNASITL ++L++L+ Sbjct 470 NDYLKDLMTGLTAKVFRTYNASITLCRQLRRLK 502 > pfa:PFE0520c topoisomerase I (EC:5.99.1.2); K03163 DNA topoisomerase I [EC:5.99.1.2] Length=839 Score = 47.0 bits (110), Expect = 1e-05, Method: Composition-based stats. Identities = 20/31 (64%), Positives = 29/31 (93%), Gaps = 0/31 (0%) Query 4 HLKQLMPGLSAKMFRTYNASITLQQELQKLQ 34 +LK++MP LSAK+FRTYNASITL Q+L++++ Sbjct 556 YLKEIMPTLSAKVFRTYNASITLDQQLKRIK 586 > ath:AT5G55310 TOP1BETA (DNA TOPOISOMERASE 1 BETA); DNA topoisomerase type I; K03163 DNA topoisomerase I [EC:5.99.1.2] Length=917 Score = 46.2 bits (108), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 21/29 (72%), Positives = 24/29 (82%), Gaps = 0/29 (0%) Query 4 HLKQLMPGLSAKMFRTYNASITLQQELQK 32 HLK+LM GL+AK+FRTYNASITL L K Sbjct 720 HLKELMAGLTAKVFRTYNASITLDLMLSK 748 > tpv:TP02_0198 DNA topoisomerase I; K03163 DNA topoisomerase I [EC:5.99.1.2] Length=1003 Score = 45.4 bits (106), Expect = 4e-05, Method: Composition-based stats. Identities = 20/36 (55%), Positives = 30/36 (83%), Gaps = 0/36 (0%) Query 4 HLKQLMPGLSAKMFRTYNASITLQQELQKLQPTLRK 39 +L++LM GLSAK+FRTYNASITLQ + ++L+ ++ Sbjct 693 YLRELMDGLSAKVFRTYNASITLQNQFKRLRSKYKR 728 > xla:399263 top1.1, top1; topoisomerase (DNA) I, gene 1 (EC:5.99.1.2); K03163 DNA topoisomerase I [EC:5.99.1.2] Length=829 Score = 44.7 bits (104), Expect = 7e-05, Method: Composition-based stats. Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%) Query 4 HLKQLMPGLSAKMFRTYNASITLQQELQKL 33 HL+ LM GL+AK+FRTYNASITLQQ+L +L Sbjct 632 HLQDLMEGLTAKVFRTYNASITLQQQLDEL 661 > cel:M01E5.5 top-1; TOPoisomerase family member (top-1); K03163 DNA topoisomerase I [EC:5.99.1.2] Length=806 Score = 44.3 bits (103), Expect = 9e-05, Method: Composition-based stats. Identities = 21/31 (67%), Positives = 27/31 (87%), Gaps = 0/31 (0%) Query 3 NHLKQLMPGLSAKMFRTYNASITLQQELQKL 33 +HL+ LM GL+ K+FRTYNASITLQ++L KL Sbjct 624 DHLRSLMDGLTVKVFRTYNASITLQEQLIKL 654 > dre:327179 top1, fd15f07, wu:fd15f07; topoisomerase (DNA) I Length=748 Score = 44.3 bits (103), Expect = 9e-05, Method: Composition-based stats. Identities = 22/41 (53%), Positives = 31/41 (75%), Gaps = 0/41 (0%) Query 4 HLKQLMPGLSAKMFRTYNASITLQQELQKLQPTLRKFKEEV 44 +L++LM GL+AK+FRTYNASITLQQ+L +L E++ Sbjct 559 YLQELMDGLTAKVFRTYNASITLQQQLNELTSPGENIPEKI 599 > cpv:cgd7_3350 eukaryotic DNA topoisomerase I ; K03163 DNA topoisomerase I [EC:5.99.1.2] Length=653 Score = 44.3 bits (103), Expect = 9e-05, Method: Composition-based stats. Identities = 20/30 (66%), Positives = 27/30 (90%), Gaps = 0/30 (0%) Query 4 HLKQLMPGLSAKMFRTYNASITLQQELQKL 33 +LK +MP LSAK+FRT+NASITL++EL K+ Sbjct 414 YLKSIMPELSAKVFRTFNASITLERELSKI 443 > sce:YOL006C TOP1, MAK1, MAK17; Top1p (EC:5.99.1.2); K03163 DNA topoisomerase I [EC:5.99.1.2] Length=769 Score = 43.1 bits (100), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 17/27 (62%), Positives = 23/27 (85%), Gaps = 0/27 (0%) Query 4 HLKQLMPGLSAKMFRTYNASITLQQEL 30 +L+ MPGL+AK+FRTYNAS T+Q +L Sbjct 503 YLQNYMPGLTAKVFRTYNASKTMQDQL 529 > dre:415098 top1mt; mitochondrial topoisomerase I (EC:5.99.1.2) Length=600 Score = 40.4 bits (93), Expect = 0.001, Method: Compositional matrix adjust. Identities = 18/29 (62%), Positives = 23/29 (79%), Gaps = 0/29 (0%) Query 5 LKQLMPGLSAKMFRTYNASITLQQELQKL 33 L + M GL+AK+FRT+NAS TLQ +L KL Sbjct 412 LTESMSGLTAKVFRTFNASTTLQDQLNKL 440 > bbo:BBOV_II003820 18.m06321; sf-assemblin/beta giardin family protein Length=345 Score = 29.3 bits (64), Expect = 3.5, Method: Compositional matrix adjust. Identities = 18/69 (26%), Positives = 34/69 (49%), Gaps = 2/69 (2%) Query 29 ELQKLQPTLRKFKEEVEREGLKKVGKAKAKKVKEEPAAAAAAAATAAAAAAAAAATEDEP 88 E+Q ++ + FK E++ GLK+ +++ K++KE+ A+ + A A A D Sbjct 266 EMQNVEKQYQDFKTELD--GLKRQSESREKEIKEKVLNKLASLSNELTAEACARENADNI 323 Query 89 QSAFNFCLM 97 + C M Sbjct 324 MTQALHCYM 332 Lambda K H 0.311 0.120 0.313 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2044474180 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40