bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_3256_orf1 Length=98 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_054690 phospholipase/carboxylesterase domain contai... 66.6 2e-11 hsa:84945 ABHD13, BEM46L1, C13orf6, FLJ14906, MGC27058, RP11-1... 45.4 4e-05 mmu:68904 Abhd13, 1110065L07Rik, AI463703, AI788994; abhydrola... 44.3 9e-05 dre:561333 abhd13, MGC123286, zgc:123286; abhydrolase domain c... 43.9 1e-04 cpv:cgd3_730 conserved expressed protein ; K06889 42.7 3e-04 xla:100049138 hypothetical protein LOC100049138 40.4 0.001 xla:432053 abhd13, MGC83139; abhydrolase domain containing 13;... 40.4 0.001 ath:AT5G20520 WAV2; WAV2 (WAVY GROWTH 2); K06889 39.7 0.002 sce:YNL320W Putative protein of unknown function; the authenti... 35.8 0.031 tgo:TGME49_062490 hypothetical protein 28.5 5.6 > tgo:TGME49_054690 phospholipase/carboxylesterase domain containing protein (EC:3.1.-.-); K06889 Length=497 Score = 66.6 bits (161), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 30/55 (54%), Positives = 39/55 (70%), Gaps = 2/55 (3%) Query 3 KLVPPSHMDVLYSSCGARLKLREDVENGGHNDTWE--VGGQSYYNRLREFVQVAL 55 +LVP HM L+ C + LK +EDV GGHNDTWE +GG+SYY+R+ F+Q AL Sbjct 269 ELVPTRHMKKLFELCPSPLKEKEDVPLGGHNDTWEWAIGGKSYYDRIAAFIQHAL 323 > hsa:84945 ABHD13, BEM46L1, C13orf6, FLJ14906, MGC27058, RP11-153I24.2, bA153I24.2; abhydrolase domain containing 13; K06889 Length=337 Score = 45.4 bits (106), Expect = 4e-05, Method: Composition-based stats. Identities = 21/67 (31%), Positives = 36/67 (53%), Gaps = 2/67 (2%) Query 1 STKLVPPSHMDVLYSSCGARLKLREDVENGGHNDTWEVGGQSYYNRLREFVQVALSASTS 60 S +L+PP M LY +R K +G HNDTW+ Q Y+ L +F++ + + + Sbjct 267 SDQLIPPVMMKQLYELSPSRTKRLAIFPDGTHNDTWQC--QGYFTALEQFIKEVVKSHSP 324 Query 61 SEVSRAS 67 E+++ S Sbjct 325 EEMAKTS 331 > mmu:68904 Abhd13, 1110065L07Rik, AI463703, AI788994; abhydrolase domain containing 13; K06889 Length=337 Score = 44.3 bits (103), Expect = 9e-05, Method: Composition-based stats. Identities = 20/67 (29%), Positives = 36/67 (53%), Gaps = 2/67 (2%) Query 1 STKLVPPSHMDVLYSSCGARLKLREDVENGGHNDTWEVGGQSYYNRLREFVQVALSASTS 60 S +L+PP M LY +R K +G HNDTW+ Q Y+ L +F++ + + + Sbjct 267 SDQLIPPVMMKQLYELSPSRTKRLAIFPDGTHNDTWQC--QGYFTALEQFIKEVIKSHSP 324 Query 61 SEVSRAS 67 ++++ S Sbjct 325 EDMTKTS 331 > dre:561333 abhd13, MGC123286, zgc:123286; abhydrolase domain containing 13; K06889 Length=337 Score = 43.9 bits (102), Expect = 1e-04, Method: Composition-based stats. Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 2/73 (2%) Query 1 STKLVPPSHMDVLYSSCGARLKLREDVENGGHNDTWEVGGQSYYNRLREFVQVALSASTS 60 S +L+PP M LY +R K G HNDTW+ Q Y++ L +F++ L + Sbjct 267 SDQLIPPVMMKQLYELSPSRTKRLAIFPEGTHNDTWQC--QGYFSALEQFMKELLKSHAR 324 Query 61 SEVSRASGAHSTI 73 E ++ + + + I Sbjct 325 EETTQGTASVTII 337 > cpv:cgd3_730 conserved expressed protein ; K06889 Length=419 Score = 42.7 bits (99), Expect = 3e-04, Method: Composition-based stats. Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 2/58 (3%) Query 3 KLVPPSHMDVLYSSCGARLKLRED--VENGGHNDTWEVGGQSYYNRLREFVQVALSAS 58 +++PP+H LY G+ L++ V G HNDTW GG +Y L +F+ A+ S Sbjct 319 EIIPPTHSVELYMKAGSPKSLKKIYLVSGGSHNDTWIKGGMEFYLMLLQFIYNAIDYS 376 > xla:100049138 hypothetical protein LOC100049138 Length=336 Score = 40.4 bits (93), Expect = 0.001, Method: Composition-based stats. Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 2/52 (3%) Query 1 STKLVPPSHMDVLYSSCGARLKLREDVENGGHNDTWEVGGQSYYNRLREFVQ 52 S +L+PP M LY +R K +G HNDTW+ Q Y+ L +F++ Sbjct 267 SDQLIPPFMMKQLYELSPSRTKRLAIFPDGTHNDTWQC--QGYFTALEQFIK 316 > xla:432053 abhd13, MGC83139; abhydrolase domain containing 13; K06889 Length=336 Score = 40.4 bits (93), Expect = 0.001, Method: Composition-based stats. Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 2/52 (3%) Query 1 STKLVPPSHMDVLYSSCGARLKLREDVENGGHNDTWEVGGQSYYNRLREFVQ 52 S +L+PP M LY +R K +G HNDTW+ Q Y+ L +F++ Sbjct 267 SDQLIPPFMMKQLYELSPSRTKRLAIFPDGTHNDTWQC--QGYFTALEQFIK 316 > ath:AT5G20520 WAV2; WAV2 (WAVY GROWTH 2); K06889 Length=308 Score = 39.7 bits (91), Expect = 0.002, Method: Composition-based stats. Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 2/52 (3%) Query 3 KLVPPSHMDVLYSSCGARLKLREDVE--NGGHNDTWEVGGQSYYNRLREFVQ 52 ++VPP HM +LY+ AR VE +G H DTW GG+ Y+ +F++ Sbjct 244 EMVPPFHMKMLYAKAAARNPQCTFVEFPSGMHMDTWLSGGEVYWKTNLQFLE 295 > sce:YNL320W Putative protein of unknown function; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies; K06889 Length=284 Score = 35.8 bits (81), Expect = 0.031, Method: Compositional matrix adjust. Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 2/49 (4%) Query 3 KLVPPSHMDVLYSSCGARLKLREDVENGGHNDTWEVGGQSYYNRLREFV 51 ++VPP HM LY +C + K + G HNDT + Y++ +R+F+ Sbjct 232 EIVPPFHMRKLYETCPSSNKKIFEFPLGSHNDT--IIQDGYWDIIRDFL 278 > tgo:TGME49_062490 hypothetical protein Length=260 Score = 28.5 bits (62), Expect = 5.6, Method: Compositional matrix adjust. Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Query 3 KLVPPSHMDVLYSSCGARLKLREDVENGGHNDTWEVGGQSYYNRLREFVQVALSAST 59 ++VP H LY+ C + VE GGHN+ +G +++Y + F++ + T Sbjct 189 EIVPVHHGMELYNRCPLSVTPYW-VEGGGHNNLELLGRRTFYENVARFLKFVRARET 244 Lambda K H 0.310 0.122 0.346 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2050913756 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40