bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_3598_orf1 Length=174 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_048810 hypothetical protein ; K07466 replication fa... 95.5 8e-20 ath:AT4G35690 hypothetical protein 32.0 0.98 sce:YOR137C SIA1; Protein of unassigned function involved in a... 30.0 3.8 > tgo:TGME49_048810 hypothetical protein ; K07466 replication factor A1 Length=497 Score = 95.5 bits (236), Expect = 8e-20, Method: Compositional matrix adjust. Identities = 49/156 (31%), Positives = 85/156 (54%), Gaps = 11/156 (7%) Query 30 AFTLNSGPYRNIPIYVHLAKGLPADAWEQVHTNPLFGEWAANLCHEGRLKADRITIQQVK 89 F+L + + + V L + WE++ ++ +F +W + RL+ R+ ++ + Sbjct 14 GFSLTTQSHGECKVRVDLPSSISQADWERIFSSRMFQDWLSVYATADRLRLLRVALESSQ 73 Query 90 ----------PEICMNVEATTSQGTSVSGPVVLRPMQSAILIVLRNSVTNLELCVFCKRP 139 + M VEA +G SGPV LRP + A+L++LRN+ T ++C+F K+P Sbjct 74 HCKSSGEEKLTSVAMLVEAADKEGEVFSGPVYLRPQRRAVLVLLRNTETRTDMCLFVKKP 133 Query 140 ELATGLSESLGLVEGSFDAE-GKLEGPCAALLEKHL 174 L+ GL+++L L EG F+AE G+ GP A +E+ L Sbjct 134 NLSVGLADTLELPEGEFEAETGRFVGPAAEEVERQL 169 > ath:AT4G35690 hypothetical protein Length=284 Score = 32.0 bits (71), Expect = 0.98, Method: Compositional matrix adjust. Identities = 20/48 (41%), Positives = 26/48 (54%), Gaps = 5/48 (10%) Query 124 RNSVTNLELCVFCKRPELATGLSESLGLVEGSFDA-EGKLEGPCAALL 170 +N + NL+L +FC R +L L E VE S D E KLEG L+ Sbjct 229 KNELENLDLEIFCSRNDLQKKLEE----VEMSIDGFEKKLEGLFRRLI 272 > sce:YOR137C SIA1; Protein of unassigned function involved in activation of the Pma1p plasma membrane H+-ATPase by glucose Length=622 Score = 30.0 bits (66), Expect = 3.8, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 23/35 (65%), Gaps = 6/35 (17%) Query 13 TRMAESFTVESTDAASSAFTLNSGPYRNIPIYVHL 47 TR++++ TVE+ ++L SGP+ N +YVHL Sbjct 93 TRVSKNITVETL------YSLQSGPFYNSYLYVHL 121 Lambda K H 0.319 0.133 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 4471152252 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40