bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_3761_orf2 Length=89 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_094360 ubiquitin carboxyl-terminal hydrolase, putat... 111 6e-25 pfa:PF13_0096 Ubiquitin Carboxyl-terminal Hydrolase-like zinc ... 68.9 4e-12 tpv:TP02_0821 ubiquitin carboxyl-terminal hydrolase; K12847 U4... 67.8 7e-12 dre:790924 usp39, wu:fb54d10, wu:fb79f05, zgc:158428; ubiquiti... 65.5 4e-11 hsa:10713 USP39, HSPC332, MGC75069, SAD1, SNRNP65; ubiquitin s... 65.5 4e-11 mmu:28035 Usp39, AA408960, AI894154, CGI-21, D6Wsu157e, SAD1; ... 64.7 7e-11 bbo:BBOV_II005180 18.m06428; u4/u6.u5 tri-snRNP-associated 65 ... 58.9 3e-09 ath:AT4G22350 ubiquitin carboxyl-terminal hydrolase family pro... 55.5 4e-08 ath:AT4G22285 ubiquitin thiolesterase/ zinc ion binding 54.3 8e-08 cpv:cgd5_2350 SnRNP assembly defective 1 like ubiquitin C-term... 52.0 5e-07 cel:F09D1.1 hypothetical protein; K12847 U4/U6.U5 tri-snRNP-as... 51.6 7e-07 hsa:8237 USP11, UHX1; ubiquitin specific peptidase 11 (EC:3.4.... 40.4 0.001 mmu:236733 Usp11, 6230415D12Rik, KIAA4085, MGC6649, mKIAA4085;... 40.0 0.002 dre:494031 usp2a, zgc:92134; ubiquitin specific peptidase 2a (... 37.7 0.008 hsa:9099 USP2, UBP41, USP9; ubiquitin specific peptidase 2 (EC... 36.2 0.028 dre:564487 usp31; ubiquitin specific peptidase 31; K11852 ubiq... 35.8 0.031 mmu:30941 Usp21, ESTM28, Usp16, Usp23, W53272; ubiquitin speci... 35.8 0.033 mmu:53376 Usp2, B930035K21Rik, Ubp41; ubiquitin specific pepti... 35.8 0.035 hsa:27005 USP21, MGC3394, USP16, USP23; ubiquitin specific pep... 35.8 0.038 dre:100334088 ubiquitin specific peptidase 15-like 35.0 0.061 dre:564054 ubiquitin specific peptidase 2-like; K11833 ubiquit... 34.7 0.073 dre:100002673 ubiquitin specific peptidase 2-like; K11833 ubiq... 34.7 0.073 mmu:381944 Dub1a, DUB-1A; deubiquitinating enzyme 1a; K11845 u... 34.3 0.11 mmu:170822 Usp33, 9830169D19Rik, AA409780, Vdu1; ubiquitin spe... 33.9 0.12 xla:100158436 usp20; ubiquitin specific peptidase 20 (EC:3.4.1... 33.1 0.20 dre:100329380 ubiquitin specific peptidase 15-like 33.1 0.22 dre:393962 usp20, MGC63661, im:7151955, zgc:63661; ubiquitin s... 32.7 0.26 sce:YJL197W UBP12; Ubiquitin carboxyl-terminal hydrolase, ubiq... 32.3 0.34 hsa:23032 USP33, KIAA1097, MGC16868, VDU1; ubiquitin specific ... 32.3 0.36 ath:AT4G17895 UBP20; UBP20 (UBIQUITIN-SPECIFIC PROTEASE 20); u... 32.0 0.49 mmu:74270 Usp20, 1700055M05Rik, AI467231, Vdu2; ubiquitin spec... 32.0 0.49 dre:100149276 ubiquitin specific protease 43-like; K11856 ubiq... 32.0 0.50 xla:398480 usp4, MGC130831; ubiquitin specific peptidase 4 (pr... 31.6 0.59 cel:E01B7.1 hypothetical protein; K11839 ubiquitin carboxyl-te... 31.6 0.68 ath:AT5G46740 UBP21; UBP21 (UBIQUITIN-SPECIFIC PROTEASE 21); u... 31.6 0.72 hsa:10868 USP20, KIAA1003, LSFR3A, VDU2; ubiquitin specific pe... 31.6 0.72 mmu:384701 Dub2a, Dub4; deubiquitinating enzyme 2a; K11845 ubi... 31.2 0.82 hsa:377630 USP17L2, DUB3; ubiquitin specific peptidase 17-like... 31.2 0.88 cel:K09A9.4 hypothetical protein 30.8 1.1 dre:406508 usp33, zgc:77308; ubiquitin specific peptidase 33 (... 30.4 1.3 sce:YLR044C PDC1; Major of three pyruvate decarboxylase isozym... 30.0 1.9 hsa:124739 USP43, FLJ30626; ubiquitin specific peptidase 43 (E... 29.6 2.1 mmu:13531 Dub1; deubiquitinating enzyme 1 (EC:3.4.19.12); K118... 29.6 2.2 ath:AT5G11310 pentatricopeptide (PPR) repeat-containing protein 29.6 2.4 mmu:13532 Usp17l5, Dub2, Dub2b; ubiquitin specific peptidase 1... 29.6 2.5 ath:AT5G43990 SUVR2; SUVR2; histone-lysine N-methyltransferase... 29.3 3.0 cel:Y67D2.2 hypothetical protein; K11851 ubiquitin carboxyl-te... 29.3 3.1 ath:AT1G32850 UBP11; UBP11 (UBIQUITIN-SPECIFIC PROTEASE 11); c... 29.3 3.2 ath:AT5G22030 UBP8; UBP8 (UBIQUITIN-SPECIFIC PROTEASE 8); ubiq... 29.3 3.4 mmu:75083 Usp50, 1700086G18Rik, 4930511O11Rik; ubiquitin speci... 28.9 3.7 > tgo:TGME49_094360 ubiquitin carboxyl-terminal hydrolase, putative (EC:4.1.1.70 3.1.2.15); K12847 U4/U6.U5 tri-snRNP-associated protein 2 Length=571 Score = 111 bits (277), Expect = 6e-25, Method: Compositional matrix adjust. Identities = 51/72 (70%), Positives = 59/72 (81%), Gaps = 0/72 (0%) Query 1 QGKPHDGFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQRQDVMADGSLDE 60 QGKPHDG YK VLHAPTNEW E+EDLRVT VLPQFVALSE+Y+Q YQRQDV DGS+D Sbjct 455 QGKPHDGQYKVHVLHAPTNEWFEIEDLRVTQVLPQFVALSESYVQVYQRQDVAPDGSIDR 514 Query 61 ALQQKCLQEMKK 72 + + LQE++K Sbjct 515 CVVEAALQELQK 526 > pfa:PF13_0096 Ubiquitin Carboxyl-terminal Hydrolase-like zinc finger protein; K12847 U4/U6.U5 tri-snRNP-associated protein 2 Length=640 Score = 68.9 bits (167), Expect = 4e-12, Method: Composition-based stats. Identities = 31/57 (54%), Positives = 39/57 (68%), Gaps = 0/57 (0%) Query 2 GKPHDGFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQRQDVMADGSL 58 G + G YK VL+ PTNEW+E+EDL V +LPQ V L E+ IQ YQRQDV +G + Sbjct 584 GTVNQGSYKIHVLNQPTNEWYEIEDLHVISILPQLVLLPESCIQLYQRQDVKLNGDI 640 > tpv:TP02_0821 ubiquitin carboxyl-terminal hydrolase; K12847 U4/U6.U5 tri-snRNP-associated protein 2 Length=537 Score = 67.8 bits (164), Expect = 7e-12, Method: Composition-based stats. Identities = 28/51 (54%), Positives = 37/51 (72%), Gaps = 0/51 (0%) Query 1 QGKPHDGFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQRQD 51 +GKP G +K V H P+ W +MEDL VT +LPQ VAL+E+Y+Q Y+RQD Sbjct 474 EGKPTGGIFKVHVYHPPSGNWFQMEDLLVTSILPQQVALTESYVQVYKRQD 524 > dre:790924 usp39, wu:fb54d10, wu:fb79f05, zgc:158428; ubiquitin specific peptidase 39; K12847 U4/U6.U5 tri-snRNP-associated protein 2 Length=497 Score = 65.5 bits (158), Expect = 4e-11, Method: Composition-based stats. Identities = 27/50 (54%), Positives = 38/50 (76%), Gaps = 0/50 (0%) Query 2 GKPHDGFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQRQD 51 GKP +G Y+ VLH T +W+E++DL+V +LPQ + LSEAYIQ ++RQD Sbjct 437 GKPTEGSYRIHVLHHGTGKWYELQDLQVIDILPQMITLSEAYIQIWKRQD 486 > hsa:10713 USP39, HSPC332, MGC75069, SAD1, SNRNP65; ubiquitin specific peptidase 39; K12847 U4/U6.U5 tri-snRNP-associated protein 2 Length=565 Score = 65.5 bits (158), Expect = 4e-11, Method: Composition-based stats. Identities = 27/50 (54%), Positives = 39/50 (78%), Gaps = 0/50 (0%) Query 2 GKPHDGFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQRQD 51 GKP +G Y+ VLH T +W+E++DL+VT +LPQ + LSEAYIQ ++R+D Sbjct 507 GKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRRD 556 > mmu:28035 Usp39, AA408960, AI894154, CGI-21, D6Wsu157e, SAD1; ubiquitin specific peptidase 39; K12847 U4/U6.U5 tri-snRNP-associated protein 2 Length=564 Score = 64.7 bits (156), Expect = 7e-11, Method: Composition-based stats. Identities = 27/50 (54%), Positives = 39/50 (78%), Gaps = 0/50 (0%) Query 2 GKPHDGFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQRQD 51 GKP +G Y+ VLH T +W+E++DL+VT +LPQ + LSEAYIQ ++R+D Sbjct 506 GKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRRD 555 > bbo:BBOV_II005180 18.m06428; u4/u6.u5 tri-snRNP-associated 65 kDa protein; K12847 U4/U6.U5 tri-snRNP-associated protein 2 Length=470 Score = 58.9 bits (141), Expect = 3e-09, Method: Composition-based stats. Identities = 26/40 (65%), Positives = 29/40 (72%), Gaps = 0/40 (0%) Query 1 QGKPHDGFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALS 40 QG P G YK VLH PT +W+E+EDL VT VLPQFVA S Sbjct 414 QGNPESGRYKIHVLHPPTGDWYELEDLLVTSVLPQFVAQS 453 > ath:AT4G22350 ubiquitin carboxyl-terminal hydrolase family protein; K12847 U4/U6.U5 tri-snRNP-associated protein 2 Length=510 Score = 55.5 bits (132), Expect = 4e-08, Method: Composition-based stats. Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 0/50 (0%) Query 2 GKPHDGFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQRQD 51 GKP DG+++ V W+EM+DL V LPQ V LSEAY+Q Y++Q+ Sbjct 460 GKPEDGYFRVFVQRKSQELWYEMQDLHVAETLPQMVELSEAYMQIYEQQE 509 > ath:AT4G22285 ubiquitin thiolesterase/ zinc ion binding Length=541 Score = 54.3 bits (129), Expect = 8e-08, Method: Composition-based stats. Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 0/50 (0%) Query 2 GKPHDGFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQRQD 51 GKP DG+++ V W+EM+DL V LPQ V LSEAY+Q Y++++ Sbjct 491 GKPEDGYFRVFVQRKSQELWYEMQDLHVAETLPQMVELSEAYMQIYEQEE 540 > cpv:cgd5_2350 SnRNP assembly defective 1 like ubiquitin C-terminal hydrolase with a UBP finger at the N-terminus ; K12847 U4/U6.U5 tri-snRNP-associated protein 2 Length=498 Score = 52.0 bits (123), Expect = 5e-07, Method: Composition-based stats. Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%) Query 1 QGKPHDGFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQRQDVM 53 +G G + Q+LH NEW E+ED+ V VLPQ + L+E YI Y+R D++ Sbjct 446 KGTIQSGKFLTQLLHPTRNEWIEIEDINVKVVLPQEILLNETYIIVYKRSDLI 498 > cel:F09D1.1 hypothetical protein; K12847 U4/U6.U5 tri-snRNP-associated protein 2 Length=602 Score = 51.6 bits (122), Expect = 7e-07, Method: Compositional matrix adjust. Identities = 24/61 (39%), Positives = 38/61 (62%), Gaps = 5/61 (8%) Query 1 QGKPHDGFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFY-----QRQDVMAD 55 +G DG Y+ Q++H + +W E+EDL V +LPQ + L+E+YIQ + Q +D A+ Sbjct 537 EGTFKDGNYRIQIVHEGSGKWFELEDLHVKDLLPQMIVLAESYIQIWRLNKEQTRDERAE 596 Query 56 G 56 G Sbjct 597 G 597 > hsa:8237 USP11, UHX1; ubiquitin specific peptidase 11 (EC:3.4.19.12); K11835 ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15] Length=963 Score = 40.4 bits (93), Expect = 0.001, Method: Compositional matrix adjust. Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 0/51 (0%) Query 2 GKPHDGFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQRQDV 52 G DG Y + + +WH +D V+PV + AY+ FYQRQDV Sbjct 882 GGMRDGHYTTFACNKDSGQWHYFDDNSVSPVNENQIESKAAYVLFYQRQDV 932 > mmu:236733 Usp11, 6230415D12Rik, KIAA4085, MGC6649, mKIAA4085; ubiquitin specific peptidase 11 (EC:3.4.19.12); K11835 ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15] Length=921 Score = 40.0 bits (92), Expect = 0.002, Method: Composition-based stats. Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 0/51 (0%) Query 2 GKPHDGFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQRQDV 52 G DG Y + + +WH +D V+PV + AY+ FYQRQDV Sbjct 841 GGMRDGHYTTFACNKDSGQWHYFDDNSVSPVNENQIESKAAYVLFYQRQDV 891 > dre:494031 usp2a, zgc:92134; ubiquitin specific peptidase 2a (EC:3.1.2.15); K11833 ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.1.2.15] Length=391 Score = 37.7 bits (86), Expect = 0.008, Method: Composition-based stats. Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 0/48 (0%) Query 2 GKPHDGFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQR 49 G G Y A + EW+ D RVTP+ V S+AY+ FY+R Sbjct 341 GTTMGGHYTAYCCNPENGEWYTYNDSRVTPMSASQVRSSDAYVLFYER 388 > hsa:9099 USP2, UBP41, USP9; ubiquitin specific peptidase 2 (EC:3.4.19.12); K11833 ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.1.2.15] Length=605 Score = 36.2 bits (82), Expect = 0.028, Method: Composition-based stats. Identities = 18/47 (38%), Positives = 22/47 (46%), Gaps = 0/47 (0%) Query 2 GKPHDGFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQ 48 G G Y A T EWH D VTP+ V S+AY+ FY+ Sbjct 551 GTTMGGHYTAYCRSPGTGEWHTFNDSSVTPMSSSQVRTSDAYLLFYE 597 > dre:564487 usp31; ubiquitin specific peptidase 31; K11852 ubiquitin carboxyl-terminal hydrolase 31 [EC:3.1.2.15] Length=1295 Score = 35.8 bits (81), Expect = 0.031, Method: Composition-based stats. Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 0/57 (0%) Query 1 QGKPHDGFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQRQDVMADGS 57 G H G Y A ++ +W+ +D V PV + V AYI FYQR+ + S Sbjct 687 HGNMHGGHYTAYCKNSIDGQWYCFDDSEVQPVADEDVCQQTAYILFYQRRTTIPSWS 743 > mmu:30941 Usp21, ESTM28, Usp16, Usp23, W53272; ubiquitin specific peptidase 21 (EC:3.4.19.12); K11833 ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.1.2.15] Length=566 Score = 35.8 bits (81), Expect = 0.033, Method: Composition-based stats. Identities = 21/47 (44%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Query 2 GKPHDGFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQ 48 G H G Y A L WH D RV+PV VA SE Y+ FYQ Sbjct 513 GSVHYGHYTA--LCRCQTGWHVYNDSRVSPVSENQVASSEGYVLFYQ 557 > mmu:53376 Usp2, B930035K21Rik, Ubp41; ubiquitin specific peptidase 2 (EC:3.4.19.12); K11833 ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.1.2.15] Length=619 Score = 35.8 bits (81), Expect = 0.035, Method: Composition-based stats. Identities = 18/47 (38%), Positives = 22/47 (46%), Gaps = 0/47 (0%) Query 2 GKPHDGFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQ 48 G G Y A T EWH D VTP+ V S+AY+ FY+ Sbjct 565 GTTMGGHYTAYCRSPVTGEWHTFNDSSVTPMSSSQVRTSDAYLLFYE 611 > hsa:27005 USP21, MGC3394, USP16, USP23; ubiquitin specific peptidase 21 (EC:3.4.19.12); K11833 ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.1.2.15] Length=565 Score = 35.8 bits (81), Expect = 0.038, Method: Composition-based stats. Identities = 21/47 (44%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Query 2 GKPHDGFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQ 48 G H G Y A L WH D RV+PV VA SE Y+ FYQ Sbjct 512 GSVHYGHYTA--LCRCQTGWHVYNDSRVSPVSENQVASSEGYVLFYQ 556 > dre:100334088 ubiquitin specific peptidase 15-like Length=391 Score = 35.0 bits (79), Expect = 0.061, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 0/50 (0%) Query 2 GKPHDGFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQRQD 51 G DG Y + + +W+ +D +VT + + S AY+ FYQRQD Sbjct 301 GGLRDGHYTSYARNKDNGQWYYFDDSKVTYAREEQIVTSAAYLLFYQRQD 350 > dre:564054 ubiquitin specific peptidase 2-like; K11833 ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.1.2.15] Length=398 Score = 34.7 bits (78), Expect = 0.073, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 0/42 (0%) Query 7 GFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQ 48 G Y A T EW+ D RV+P+ V S+AY+ FY+ Sbjct 350 GHYTAYCRSPCTGEWYTYNDSRVSPMSSSQVCSSDAYVLFYE 391 > dre:100002673 ubiquitin specific peptidase 2-like; K11833 ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.1.2.15] Length=398 Score = 34.7 bits (78), Expect = 0.073, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 0/42 (0%) Query 7 GFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQ 48 G Y A T EW+ D RV+P+ V S+AY+ FY+ Sbjct 350 GHYTAYCRSPCTGEWYTYNDSRVSPMSSSQVCSSDAYVLFYE 391 > mmu:381944 Dub1a, DUB-1A; deubiquitinating enzyme 1a; K11845 ubiquitin carboxyl-terminal hydrolase 17 [EC:3.1.2.15] Length=468 Score = 34.3 bits (77), Expect = 0.11, Method: Compositional matrix adjust. Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Query 5 HDGFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQRQDVMADGSLD 59 H G Y V A +W++M+D +VT V AY+ FY +Q+ + GS++ Sbjct 304 HSGHYFCCV-KAGHGKWYKMDDTKVTSCDVTSVLNENAYVLFYVQQNDLKKGSIN 357 > mmu:170822 Usp33, 9830169D19Rik, AA409780, Vdu1; ubiquitin specific peptidase 33 (EC:3.4.19.12); K11848 ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.1.2.15] Length=897 Score = 33.9 bits (76), Expect = 0.12, Method: Compositional matrix adjust. Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 0/48 (0%) Query 2 GKPHDGFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQR 49 G G Y A + N W+E +D VT V V +EAY+ FY++ Sbjct 626 GTASSGHYIAYCRNNLNNLWYEFDDQSVTEVSESTVQNAEAYVLFYRK 673 > xla:100158436 usp20; ubiquitin specific peptidase 20 (EC:3.4.19.12); K11848 ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.1.2.15] Length=840 Score = 33.1 bits (74), Expect = 0.20, Method: Composition-based stats. Identities = 27/91 (29%), Positives = 42/91 (46%), Gaps = 12/91 (13%) Query 1 QGKPHDGFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFY---------QRQD 51 G G Y + + +W+E +D VT V V +EAY+ FY +RQ Sbjct 562 HGSASSGHYISYCQNVINGQWYEFDDQYVTEVHETVVQNAEAYVLFYRKSSEEAERERQK 621 Query 52 VMADGSLDEA--LQQKCLQE-MKKVKTQAEP 79 V++ ++ E+ LQ +E + K T AEP Sbjct 622 VVSLAAMKESGLLQFYISREWLNKFNTFAEP 652 > dre:100329380 ubiquitin specific peptidase 15-like Length=317 Score = 33.1 bits (74), Expect = 0.22, Method: Compositional matrix adjust. Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 0/45 (0%) Query 9 YKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQRQDVM 53 Y A + +W+ +D V+P + + AY+ FYQRQD + Sbjct 225 YTAYAKNVEDGQWYSFDDSSVSPASEEQIVSKAAYVLFYQRQDTV 269 > dre:393962 usp20, MGC63661, im:7151955, zgc:63661; ubiquitin specific protease 20 (EC:3.1.2.15 3.4.19.12); K11848 ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.1.2.15] Length=913 Score = 32.7 bits (73), Expect = 0.26, Method: Composition-based stats. Identities = 29/91 (31%), Positives = 40/91 (43%), Gaps = 12/91 (13%) Query 1 QGKPHDGFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFY---------QRQD 51 G G Y A + +W+E +D VT V V +EAY+ FY +RQ Sbjct 636 HGTAGSGHYIAYCQNVINGQWYEFDDQYVTEVHETVVQNAEAYVLFYRKSSEESVRERQR 695 Query 52 VMADGSLDEA--LQQKCLQE-MKKVKTQAEP 79 V+A +L E LQ +E + K T EP Sbjct 696 VVALANLKEPSLLQFYISREWLNKFNTFTEP 726 > sce:YJL197W UBP12; Ubiquitin carboxyl-terminal hydrolase, ubiquitin-specific protease present in the nucleus and cytoplasm that cleaves ubiquitin from ubiquitinated proteins (EC:3.1.2.15); K11835 ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15] Length=1254 Score = 32.3 bits (72), Expect = 0.34, Method: Composition-based stats. Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 0/56 (0%) Query 9 YKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQRQDVMADGSLDEALQQ 64 Y A V + N+W+ +D RVT P+ AY+ FY R+ +G LQ+ Sbjct 1069 YTAYVKNFADNKWYYFDDSRVTETAPENSIAGSAYLLFYIRRHKDGNGLGSSKLQE 1124 > hsa:23032 USP33, KIAA1097, MGC16868, VDU1; ubiquitin specific peptidase 33 (EC:3.4.19.12); K11848 ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.1.2.15] Length=942 Score = 32.3 bits (72), Expect = 0.36, Method: Composition-based stats. Identities = 27/91 (29%), Positives = 39/91 (42%), Gaps = 12/91 (13%) Query 1 QGKPHDGFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQRQDVMADGS--- 57 G G Y A + N W+E +D VT V V +EAY+ FY++ A Sbjct 666 HGTASSGHYIAYCRNNLNNLWYEFDDQSVTEVSESTVQNAEAYVLFYRKSSEEAQKERRR 725 Query 58 -------LDEALQQKCL--QEMKKVKTQAEP 79 ++ +L Q + Q + K KT AEP Sbjct 726 ISNLLNIMEPSLLQFYISRQWLNKFKTFAEP 756 > ath:AT4G17895 UBP20; UBP20 (UBIQUITIN-SPECIFIC PROTEASE 20); ubiquitin thiolesterase/ ubiquitin-specific protease Length=695 Score = 32.0 bits (71), Expect = 0.49, Method: Composition-based stats. Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 1/57 (1%) Query 7 GFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQRQDVMADGSLDEALQ 63 G Y + V AP WH +D +VT + V ++YI FY R+ S+ E +Q Sbjct 434 GHYSSYVRSAP-KIWHHFDDSKVTRIDEDMVLSQDSYILFYAREGTRWFSSVYEEMQ 489 > mmu:74270 Usp20, 1700055M05Rik, AI467231, Vdu2; ubiquitin specific peptidase 20 (EC:3.4.19.12); K11848 ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.1.2.15] Length=916 Score = 32.0 bits (71), Expect = 0.49, Method: Composition-based stats. Identities = 22/79 (27%), Positives = 37/79 (46%), Gaps = 9/79 (11%) Query 1 QGKPHDGFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQRQDVMADGSLDE 60 G G Y A + +W+E +D VT V V EAY+ FY++ S +E Sbjct 638 HGTAGSGHYIAYCQNVINGQWYEFDDQYVTEVHETVVQNVEAYVLFYRK-------SSEE 690 Query 61 ALQQKCLQEMKKVKTQAEP 79 A++++ Q++ + EP Sbjct 691 AMRER--QQVVSLAAMREP 707 > dre:100149276 ubiquitin specific protease 43-like; K11856 ubiquitin carboxyl-terminal hydrolase 43 [EC:3.1.2.15] Length=1163 Score = 32.0 bits (71), Expect = 0.50, Method: Composition-based stats. Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 0/49 (0%) Query 9 YKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQRQDVMADGS 57 Y A ++ +W+ +D V P+ V AYI FYQR+D + S Sbjct 701 YTAYCRNSVDGQWYTYDDSSVEPLQEGEVCTRAAYILFYQRRDAIPSWS 749 > xla:398480 usp4, MGC130831; ubiquitin specific peptidase 4 (proto-oncogene); K11835 ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15] Length=975 Score = 31.6 bits (70), Expect = 0.59, Method: Compositional matrix adjust. Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 0/43 (0%) Query 9 YKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQRQD 51 Y A + ++W+ +D V+P + AY+ FYQRQD Sbjct 899 YTAYAKNQDKDQWYYFDDSSVSPASEDQIVTKAAYVLFYQRQD 941 > cel:E01B7.1 hypothetical protein; K11839 ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15] Length=811 Score = 31.6 bits (70), Expect = 0.68, Method: Composition-based stats. Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 0/48 (0%) Query 2 GKPHDGFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQR 49 G+ + G Y A H +++W +D VTP V S AYI FY+R Sbjct 763 GRLNSGHYTAVASHLRSDKWLRFDDSVVTPCENFKVDPSLAYILFYKR 810 > ath:AT5G46740 UBP21; UBP21 (UBIQUITIN-SPECIFIC PROTEASE 21); ubiquitin thiolesterase/ ubiquitin-specific protease Length=732 Score = 31.6 bits (70), Expect = 0.72, Method: Composition-based stats. Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Query 7 GFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQRQ 50 G Y + V AP WH +D +VT + + V AYI FY R+ Sbjct 427 GHYSSYVRSAPET-WHNFDDSKVTRISEERVLSRPAYILFYARE 469 > hsa:10868 USP20, KIAA1003, LSFR3A, VDU2; ubiquitin specific peptidase 20 (EC:3.4.19.12); K11848 ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.1.2.15] Length=914 Score = 31.6 bits (70), Expect = 0.72, Method: Compositional matrix adjust. Identities = 21/80 (26%), Positives = 37/80 (46%), Gaps = 9/80 (11%) Query 1 QGKPHDGFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQRQDVMADGSLDE 60 G G Y A + +W+E +D VT V V +E Y+ FY++ S +E Sbjct 636 HGTAGSGHYIAYCQNVINGQWYEFDDQYVTEVHETVVQNAEGYVLFYRK-------SSEE 688 Query 61 ALQQKCLQEMKKVKTQAEPE 80 A++++ Q++ + EP Sbjct 689 AMRER--QQVVSLAAMREPS 706 > mmu:384701 Dub2a, Dub4; deubiquitinating enzyme 2a; K11845 ubiquitin carboxyl-terminal hydrolase 17 [EC:3.1.2.15] Length=545 Score = 31.2 bits (69), Expect = 0.82, Method: Compositional matrix adjust. Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Query 5 HDGFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQRQDVMADGSLD 59 H G Y + V A +W++M+D +VT V AY+ FY +Q + + S+D Sbjct 304 HSGHYFSYV-KAGHGKWYKMDDTKVTSCDVTSVLNENAYVLFYVQQTDLKEVSID 357 > hsa:377630 USP17L2, DUB3; ubiquitin specific peptidase 17-like 2 (EC:3.4.19.12); K11845 ubiquitin carboxyl-terminal hydrolase 17 [EC:3.1.2.15] Length=530 Score = 31.2 bits (69), Expect = 0.88, Method: Compositional matrix adjust. Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Query 5 HDGFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFY 47 HDG Y + V A +W++M+D +VT V +AY+ FY Sbjct 331 HDGHYFSYV-KAQEGQWYKMDDAKVTACSITSVLSQQAYVLFY 372 > cel:K09A9.4 hypothetical protein Length=716 Score = 30.8 bits (68), Expect = 1.1, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 27/54 (50%), Gaps = 0/54 (0%) Query 7 GFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQRQDVMADGSLDE 60 G Y + H N+W++ +D+ VT VA S+ YI Y++ + S+ + Sbjct 505 GHYVSYCRHEQDNQWYKFDDMVVTRCDATQVAKSQPYILMYRKHTTNGEPSISQ 558 > dre:406508 usp33, zgc:77308; ubiquitin specific peptidase 33 (EC:3.4.19.12); K11848 ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.1.2.15] Length=897 Score = 30.4 bits (67), Expect = 1.3, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 0/51 (0%) Query 1 QGKPHDGFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQRQD 51 G G Y A + W+E +D VT V V +EAY+ FY++ + Sbjct 621 HGTASSGHYIAYCRNELNQLWYEFDDQSVTEVSESCVQNAEAYVLFYKKSN 671 > sce:YLR044C PDC1; Major of three pyruvate decarboxylase isozymes, key enzyme in alcoholic fermentation, decarboxylates pyruvate to acetaldehyde; subject to glucose-, ethanol-, and autoregulation; involved in amino acid catabolism (EC:4.1.1.74 4.1.1.72 4.1.1.1 4.1.1.-); K01568 pyruvate decarboxylase [EC:4.1.1.1] Length=563 Score = 30.0 bits (66), Expect = 1.9, Method: Composition-based stats. Identities = 16/70 (22%), Positives = 33/70 (47%), Gaps = 6/70 (8%) Query 5 HDGFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQRQDVMADGSLDEALQQ 64 +DG+ +++H P +++E++ +LP F A + Y+ V G D+ Q Sbjct 471 NDGYTIEKLIHGPKAQYNEIQGWDHLSLLPTFGA------KDYETHRVATTGEWDKLTQD 524 Query 65 KCLQEMKKVK 74 K + K++ Sbjct 525 KSFNDNSKIR 534 > hsa:124739 USP43, FLJ30626; ubiquitin specific peptidase 43 (EC:3.4.19.12); K11856 ubiquitin carboxyl-terminal hydrolase 43 [EC:3.1.2.15] Length=1123 Score = 29.6 bits (65), Expect = 2.1, Method: Composition-based stats. Identities = 15/51 (29%), Positives = 24/51 (47%), Gaps = 0/51 (0%) Query 1 QGKPHDGFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQRQD 51 G G Y A ++ +W+ +D V P+ V AYI FYQ+++ Sbjct 661 HGNLQGGHYTAYCRNSLDGQWYSYDDSTVEPLREDEVNTRGAYILFYQKRN 711 > mmu:13531 Dub1; deubiquitinating enzyme 1 (EC:3.4.19.12); K11845 ubiquitin carboxyl-terminal hydrolase 17 [EC:3.1.2.15] Length=526 Score = 29.6 bits (65), Expect = 2.2, Method: Compositional matrix adjust. Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Query 5 HDGFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQRQDVMADGSLD 59 H G Y V A +W++M+D +VT V AY+ FY +Q + S+D Sbjct 304 HSGHYFCCV-KAGHGKWYKMDDTKVTRCDVTSVLNENAYVLFYVQQANLKQVSID 357 > ath:AT5G11310 pentatricopeptide (PPR) repeat-containing protein Length=602 Score = 29.6 bits (65), Expect = 2.4, Method: Composition-based stats. Identities = 16/66 (24%), Positives = 32/66 (48%), Gaps = 6/66 (9%) Query 6 DGFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQRQDVMADGSLDEALQQK 65 +G+++++ L W EM+ + V P + + L E Y + + Q M E L++ Sbjct 258 NGWFRSRKLKQAEKLWEEMKAMNVKPTVVTYGTLIEGYCRMRRVQIAM------EVLEEM 311 Query 66 CLQEMK 71 + EM+ Sbjct 312 KMAEME 317 > mmu:13532 Usp17l5, Dub2, Dub2b; ubiquitin specific peptidase 17-like 5; K11845 ubiquitin carboxyl-terminal hydrolase 17 [EC:3.1.2.15] Length=545 Score = 29.6 bits (65), Expect = 2.5, Method: Compositional matrix adjust. Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Query 5 HDGFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQRQDVMADGSLD 59 H G Y + V A W++M+D +VT V AY+ FY +Q + S+D Sbjct 304 HSGHYFSYV-KARHGAWYKMDDTKVTSCDVTSVLNENAYVLFYVQQTDLKQVSID 357 > ath:AT5G43990 SUVR2; SUVR2; histone-lysine N-methyltransferase/ zinc ion binding Length=717 Score = 29.3 bits (64), Expect = 3.0, Method: Composition-based stats. Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 3/61 (4%) Query 24 MEDLRVTPVLPQFVALSEAYIQFYQRQD--VMADGSLDEALQQKCLQEMKKVKTQAEPED 81 +ED RV PVL +AL E + + V+AD D + + + +QE ++ K ED Sbjct 19 IEDARVKPVLKNLLALYEKNWELIAEDNYRVLADAIFD-SHEDQAIQESEEKKADEVKED 77 Query 82 E 82 E Sbjct 78 E 78 > cel:Y67D2.2 hypothetical protein; K11851 ubiquitin carboxyl-terminal hydrolase 30 [EC:3.1.2.15] Length=474 Score = 29.3 bits (64), Expect = 3.1, Method: Composition-based stats. Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Query 1 QGKPHDG-FYKAQVLHAPTNE-WHEMEDLRVTPVLPQFVALSEAYIQFYQR 49 +G P+ G F + AP + W+ D +VT V VA ++Y+ FY+R Sbjct 414 RGGPYSGHFVTYRRASAPNHHTWYYTSDAQVTRVPYSHVAACQSYMLFYER 464 > ath:AT1G32850 UBP11; UBP11 (UBIQUITIN-SPECIFIC PROTEASE 11); cysteine-type endopeptidase/ ubiquitin thiolesterase; K11835 ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15] Length=892 Score = 29.3 bits (64), Expect = 3.2, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 0/30 (0%) Query 20 EWHEMEDLRVTPVLPQFVALSEAYIQFYQR 49 +W+ +D RV+ V + S AY+ FYQR Sbjct 850 KWYNFDDSRVSAVNESEIKTSAAYVLFYQR 879 > ath:AT5G22030 UBP8; UBP8 (UBIQUITIN-SPECIFIC PROTEASE 8); ubiquitin thiolesterase/ ubiquitin-specific protease; K11835 ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15] Length=913 Score = 29.3 bits (64), Expect = 3.4, Method: Composition-based stats. Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Query 7 GFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQR 49 G Y A V H + W++ +D V + + + S AY+ FY+R Sbjct 869 GHYTAYVHHG-GDRWYDFDDSHVHQISQEKIKTSAAYVLFYKR 910 > mmu:75083 Usp50, 1700086G18Rik, 4930511O11Rik; ubiquitin specific peptidase 50 (EC:3.4.19.12) Length=390 Score = 28.9 bits (63), Expect = 3.7, Method: Composition-based stats. Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 0/44 (0%) Query 7 GFYKAQVLHAPTNEWHEMEDLRVTPVLPQFVALSEAYIQFYQRQ 50 G Y A ++ T W+ +D RV+ + V + AY+ FY Q Sbjct 320 GHYTAFCKNSVTQAWYSFDDTRVSEIPDTSVQTATAYLLFYSCQ 363 Lambda K H 0.316 0.131 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2017039696 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40