bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_3842_orf1 Length=125 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_073460 eukaryotic translation initiation factor 3 s... 87.0 1e-17 pfa:PFF0590c homologue of human HSPC025; K15029 translation in... 62.8 3e-10 xla:380037 eif3l, MGC53371, eif3s6ip; eukaryotic translation i... 51.2 9e-07 mmu:223691 Eif3l, 0610011H21Rik, D15N1e, Eif3eip, Eif3ip, Eif3... 48.5 5e-06 hsa:51386 EIF3L, EIF3EIP, EIF3S11, EIF3S6IP, HSPC025, MSTP005;... 48.5 5e-06 dre:406402 eif3s6ip, wu:fb66c05, zgc:64147; eukaryotic transla... 43.9 1e-04 bbo:BBOV_III003720 17.m07346; hypothetical protein; K15029 tra... 40.8 0.001 tpv:TP02_0247 hypothetical protein; K15029 translation initiat... 39.3 0.003 cpv:cgd2_1160 HSPC021/HSPC025 family protein ; K15029 translat... 37.0 0.017 pfa:PFF1425w RNA binding protein, putative 30.8 1.3 sce:YOL097C WRS1, HRE342; Wrs1p (EC:6.1.1.2); K01867 tryptopha... 30.0 2.2 sce:YCR077C PAT1, MRT1; Pat1p; K12617 DNA topoisomerase 2-asso... 29.3 3.6 tgo:TGME49_027390 hypothetical protein 28.9 4.7 sce:YAL002W VPS8, FUN15, VPL8, VPT8; Membrane-associated prote... 27.7 8.5 ath:AT5G25757 hypothetical protein 27.7 8.7 ath:AT5G33393 hypothetical protein 27.7 8.9 > tgo:TGME49_073460 eukaryotic translation initiation factor 3 subunit 6 interacting protein, putative ; K15029 translation initiation factor 3 subunit L Length=639 Score = 87.0 bits (214), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 41/81 (50%), Positives = 60/81 (74%), Gaps = 0/81 (0%) Query 1 PEGEVRSGLMCLKLKSQQKVWRSGPLLSGELTQPHVEALMDFKIDGEMLHVKNQQTQRVY 60 PE VRS ++ +K K +QKVWRSG LLSG+LT + ++F +D +M+HV++QQ+Q+VY Sbjct 507 PEDAVRSEILSVKYKGRQKVWRSGSLLSGDLTPSSSDNSVEFYMDQDMIHVRSQQSQKVY 566 Query 61 VDYFVKQIERSDALMLAAQHA 81 VD F+KQIERS L + Q++ Sbjct 567 VDQFLKQIERSQHLFNSIQNS 587 > pfa:PFF0590c homologue of human HSPC025; K15029 translation initiation factor 3 subunit L Length=656 Score = 62.8 bits (151), Expect = 3e-10, Method: Composition-based stats. Identities = 28/74 (37%), Positives = 46/74 (62%), Gaps = 0/74 (0%) Query 2 EGEVRSGLMCLKLKSQQKVWRSGPLLSGELTQPHVEALMDFKIDGEMLHVKNQQTQRVYV 61 E V S +MC+K S+Q +W+ GPL +G++ DF ID +++++K + Q++++ Sbjct 465 EQNVSSDIMCVKNCSKQLIWKEGPLYTGDIINSIFGNSFDFFIDLDIVNIKTRAHQKIFI 524 Query 62 DYFVKQIERSDALM 75 DYFV QI S LM Sbjct 525 DYFVHQINMSKNLM 538 > xla:380037 eif3l, MGC53371, eif3s6ip; eukaryotic translation initiation factor 3, subunit L; K15029 translation initiation factor 3 subunit L Length=562 Score = 51.2 bits (121), Expect = 9e-07, Method: Compositional matrix adjust. Identities = 27/75 (36%), Positives = 41/75 (54%), Gaps = 4/75 (5%) Query 1 PEGEVRSGLMCLKLKSQQKVWRSG-PLLSGELTQPHVEALMDFKIDGEMLHVKNQQTQRV 59 PE E R L+ K K + VW SG L GE + +DF ID +M+H+ + + R Sbjct 480 PEQEFRIQLLVFKHKMKNLVWTSGISALEGEFQSA---SEVDFYIDKDMIHIADTKVARR 536 Query 60 YVDYFVKQIERSDAL 74 Y D+F++QI + + L Sbjct 537 YGDFFIRQIHKFEEL 551 > mmu:223691 Eif3l, 0610011H21Rik, D15N1e, Eif3eip, Eif3ip, Eif3s6ip, HSP-66Y, MGC37328, PAF67; eukaryotic translation initiation factor 3, subunit L; K15029 translation initiation factor 3 subunit L Length=564 Score = 48.5 bits (114), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 4/74 (5%) Query 2 EGEVRSGLMCLKLKSQQKVWRSG-PLLSGELTQPHVEALMDFKIDGEMLHVKNQQTQRVY 60 E E R L+ K K + VW SG L GE + +DF ID +M+H+ + + R Y Sbjct 483 EQEFRIQLLVFKHKMKNLVWTSGISALDGEFQSA---SEVDFYIDKDMIHIADTKVARRY 539 Query 61 VDYFVKQIERSDAL 74 D+F++QI + + L Sbjct 540 GDFFIRQIHKFEEL 553 > hsa:51386 EIF3L, EIF3EIP, EIF3S11, EIF3S6IP, HSPC025, MSTP005; eukaryotic translation initiation factor 3, subunit L; K15029 translation initiation factor 3 subunit L Length=564 Score = 48.5 bits (114), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 4/74 (5%) Query 2 EGEVRSGLMCLKLKSQQKVWRSG-PLLSGELTQPHVEALMDFKIDGEMLHVKNQQTQRVY 60 E E R L+ K K + VW SG L GE + +DF ID +M+H+ + + R Y Sbjct 483 EQEFRIQLLVFKHKMKNLVWTSGISALDGEFQSA---SEVDFYIDKDMIHIADTKVARRY 539 Query 61 VDYFVKQIERSDAL 74 D+F++QI + + L Sbjct 540 GDFFIRQIHKFEEL 553 > dre:406402 eif3s6ip, wu:fb66c05, zgc:64147; eukaryotic translation initiation factor 3, subunit 6 interacting protein; K15029 translation initiation factor 3 subunit L Length=576 Score = 43.9 bits (102), Expect = 1e-04, Method: Composition-based stats. Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 4/74 (5%) Query 2 EGEVRSGLMCLKLKSQQKVWRSG-PLLSGELTQPHVEALMDFKIDGEMLHVKNQQTQRVY 60 E E R L+ K K + VW SG L GE + +DF ID +M+H+ + + R Y Sbjct 482 EQEFRIQLLVFKHKMKNLVWTSGISALDGEFQSA---SEVDFYIDKDMIHIADTKVARRY 538 Query 61 VDYFVKQIERSDAL 74 D+F++QI + + L Sbjct 539 GDFFIRQIHKFEEL 552 > bbo:BBOV_III003720 17.m07346; hypothetical protein; K15029 translation initiation factor 3 subunit L Length=542 Score = 40.8 bits (94), Expect = 0.001, Method: Composition-based stats. Identities = 21/66 (31%), Positives = 42/66 (63%), Gaps = 3/66 (4%) Query 5 VRSGLMCLKLKSQQKVWRSGPLLSGELTQPHVEALMDFKIDGEMLHVKNQQTQRVYVDYF 64 VRS ++ +K +++Q S G++ E +D ID +L++K++++Q+++VDYF Sbjct 453 VRSYVLSVKHQTRQFANSSS---GGDVIPGTAEGDIDLYIDQNILYIKSKRSQKLFVDYF 509 Query 65 VKQIER 70 ++QI R Sbjct 510 LQQINR 515 > tpv:TP02_0247 hypothetical protein; K15029 translation initiation factor 3 subunit L Length=544 Score = 39.3 bits (90), Expect = 0.003, Method: Composition-based stats. Identities = 22/66 (33%), Positives = 38/66 (57%), Gaps = 1/66 (1%) Query 5 VRSGLMCLKLKSQQKVWRSGPLLSGELTQPHVEALMDFKIDGEMLHVKNQQTQRVYVDYF 64 +RS ++C K +Q V S L L Q + D ID +LH+K+++ Q++Y +YF Sbjct 453 LRSQILCAKHHVRQFVSNSFSLYHTNLLQTFGDR-DDLYIDQNVLHIKSKKNQKIYAEYF 511 Query 65 VKQIER 70 ++QI + Sbjct 512 LQQINK 517 > cpv:cgd2_1160 HSPC021/HSPC025 family protein ; K15029 translation initiation factor 3 subunit L Length=673 Score = 37.0 bits (84), Expect = 0.017, Method: Composition-based stats. Identities = 26/77 (33%), Positives = 46/77 (59%), Gaps = 4/77 (5%) Query 1 PEGEVRSGLMCLKLKS-QQKVWRSGPLLSGELTQPHVEALMDFKIDGEMLH-VKNQQTQR 58 P RS ++ +K +S +QK+W+SG L SGEL Q + +D +D + +H ++ +Q + Sbjct 579 PSSIARSQIIAIKSRSGRQKIWKSGDLHSGELVQ--LNGDVDLLLDLDTIHIIEGKQVDK 636 Query 59 VYVDYFVKQIERSDALM 75 + D F KQI ++ L+ Sbjct 637 FFGDIFAKQILKARNLL 653 > pfa:PFF1425w RNA binding protein, putative Length=780 Score = 30.8 bits (68), Expect = 1.3, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 0/30 (0%) Query 85 PAPQLQQLQPLQPLQQPQQLQQLQQDTPAN 114 P QL QL PL L Q + QL Q P N Sbjct 422 PLNQLNQLNPLNQLNQLNPMNQLNQLNPMN 451 > sce:YOL097C WRS1, HRE342; Wrs1p (EC:6.1.1.2); K01867 tryptophanyl-tRNA synthetase [EC:6.1.1.2] Length=432 Score = 30.0 bits (66), Expect = 2.2, Method: Composition-based stats. Identities = 24/79 (30%), Positives = 38/79 (48%), Gaps = 9/79 (11%) Query 14 LKSQQKVWRSGPLLSGELTQPHVEALMDFKIDGEMLHVKNQQTQRVYVD-YFVKQIERSD 72 LK ++SG LLSGE+ + +E L +F VK Q +R VD + + Sbjct 359 LKECYDKYKSGELLSGEMKKLCIETLQEF--------VKAFQERRAQVDEETLDKFMVPH 410 Query 73 ALMLAAQHAVVAPAPQLQQ 91 L+ + +VAP P+ +Q Sbjct 411 KLVWGEKERLVAPKPKTKQ 429 > sce:YCR077C PAT1, MRT1; Pat1p; K12617 DNA topoisomerase 2-associated protein PAT1 Length=796 Score = 29.3 bits (64), Expect = 3.6, Method: Composition-based stats. Identities = 12/26 (46%), Positives = 17/26 (65%), Gaps = 0/26 (0%) Query 80 HAVVAPAPQLQQLQPLQPLQQPQQLQ 105 + +APAP QQ+ PLQP+ Q L+ Sbjct 123 QSTMAPAPAPQQMAPLQPILSMQDLE 148 > tgo:TGME49_027390 hypothetical protein Length=1047 Score = 28.9 bits (63), Expect = 4.7, Method: Compositional matrix adjust. Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 2/58 (3%) Query 55 QTQRVYVDYFVKQIERSDALMLAAQHAVVAPAPQLQQLQPLQPLQQPQQLQQLQQDTP 112 T V + YF+ ++ER DA + P P+ ++ QPL L P ++ + DTP Sbjct 413 DTDTVTLLYFLFEVERGDASRFRFFFQEMVPPPRDERQQPL--LLGPPEIPEFLGDTP 468 > sce:YAL002W VPS8, FUN15, VPL8, VPT8; Membrane-associated protein that interacts with Vps21p to facilitate soluble vacuolar protein localization; component of the CORVET complex; required for localization and trafficking of the CPY sorting receptor; contains RING finger motif Length=1274 Score = 27.7 bits (60), Expect = 8.5, Method: Composition-based stats. Identities = 10/22 (45%), Positives = 17/22 (77%), Gaps = 0/22 (0%) Query 41 DFKIDGEMLHVKNQQTQRVYVD 62 D+ + E+L VKN++TQ+ Y+D Sbjct 935 DYNLHQEILEVKNEETQQKYLD 956 > ath:AT5G25757 hypothetical protein Length=514 Score = 27.7 bits (60), Expect = 8.7, Method: Composition-based stats. Identities = 11/38 (28%), Positives = 25/38 (65%), Gaps = 0/38 (0%) Query 38 ALMDFKIDGEMLHVKNQQTQRVYVDYFVKQIERSDALM 75 A +DF I+ +M++V + + Y D+F++QI + + ++ Sbjct 468 ADIDFFINNDMIYVVESKPAKRYGDFFLRQIAKLEGVI 505 > ath:AT5G33393 hypothetical protein Length=435 Score = 27.7 bits (60), Expect = 8.9, Method: Compositional matrix adjust. Identities = 20/43 (46%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Query 81 AVVAPAPQLQQL-QPLQPLQQPQQLQQLQQDTPANARDRRKPQ 122 +V P+ QQ Q L P+Q QQL Q QQ T N RRKP+ Sbjct 388 VIVQPSFASQQAPQRLAPIQVKQQLLQAQQYTWNNDDQRRKPK 430 Lambda K H 0.318 0.131 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2064871684 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40