bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_3864_orf1 Length=174 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_023410 eukaryotic translation initiation factor 4E,... 80.1 3e-15 cpv:cgd6_1020 translation initiation factor if-4E ; K03259 tra... 49.3 6e-06 pfa:PFC0635c translation initiation factor E4, putative; K0325... 46.6 4e-05 tpv:TP02_0735 translation initiation factor E4; K03259 transla... 45.4 9e-05 bbo:BBOV_III011150 17.m10646; translation initiation factor E4... 41.6 0.001 mmu:244958 Mrap2, BB633055; melanocortin 2 receptor accessory ... 38.5 0.011 hsa:112609 MRAP2, C6orf117, RP11-51G5.2, bA51G5.2; melanocorti... 37.4 0.027 dre:550549 eif4e1c, eif4E-1C, fb57e09, wu:fb57e09, zgc:110154;... 32.7 0.56 dre:30738 eif4e1b, Z4ES, eif4e, zeIF4E; eukaryotic translation... 30.8 2.4 mmu:102098 Arhgef18, AI467246, D030053O22Rik; rho/rac guanine ... 30.0 4.7 hsa:1977 EIF4E, CBP, EIF4E1, EIF4EL1, EIF4F, MGC111573; eukary... 29.6 4.8 xla:399255 eif4e, MGC84530; eIF-4E protein; K03259 translation... 29.6 5.4 mmu:13684 Eif4e, EG668879, Eif4e-ps, If4e, MGC103177, eIF-4E; ... 29.6 5.5 xla:734259 eif4e, MGC85107, eIF-4E, eif4e1; eukaryotic transla... 29.6 5.6 dre:100332201 eukaryotic translation initiation factor 4E-1A-like 29.6 5.8 tgo:TGME49_010780 ubiquitin carboxyl-terminal hydrolase, putat... 29.6 6.1 dre:79380 eif4e, eif4e-1, eif4e1a, zgc:86680; eukaryotic trans... 29.3 6.1 dre:493617 zgc:101581 29.3 7.9 > tgo:TGME49_023410 eukaryotic translation initiation factor 4E, putative ; K03259 translation initiation factor 4E Length=198 Score = 80.1 bits (196), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 36/70 (51%), Positives = 52/70 (74%), Gaps = 4/70 (5%) Query 74 STKYLSFNPSVADAVNLDECITEERPADAPMPLQHRWHVWEQIQREAAAADRAADYSQNT 133 + K+LSFN + +AV+L + + EE D P+PL++ WHVWEQ+Q++ DR+ +YS NT Sbjct 2 AAKFLSFNQELNEAVDLKDWVKEEPVPDEPLPLRYVWHVWEQVQQD----DRSKEYSDNT 57 Query 134 RDLASFDTVQ 143 RDLA+FDTVQ Sbjct 58 RDLAAFDTVQ 67 > cpv:cgd6_1020 translation initiation factor if-4E ; K03259 translation initiation factor 4E Length=240 Score = 49.3 bits (116), Expect = 6e-06, Method: Compositional matrix adjust. Identities = 29/73 (39%), Positives = 40/73 (54%), Gaps = 7/73 (9%) Query 75 TKYLSFNPSVADAVNLDECITE-ERPADA---PMPLQHRWHVWEQIQREAAAADRAADYS 130 +KYLSFN S+ + L +E + P D P+PL H W VWEQ+ E + DYS Sbjct 8 SKYLSFNESIEPNLTLPTACSEVDLPEDLISRPLPLSHEWIVWEQLNVETR---KDLDYS 64 Query 131 QNTRDLASFDTVQ 143 T+ +A F +VQ Sbjct 65 NATKPVARFSSVQ 77 > pfa:PFC0635c translation initiation factor E4, putative; K03259 translation initiation factor 4E Length=227 Score = 46.6 bits (109), Expect = 4e-05, Method: Compositional matrix adjust. Identities = 24/69 (34%), Positives = 39/69 (56%), Gaps = 3/69 (4%) Query 76 KYLSFNPSVADAVNLDECITEER-PADAPMPLQHRWHVWEQIQREAAAADRAADYSQNTR 134 KYL+FN + DA++L E + + P+ LQ+ W +WEQ+ ++ +Y TR Sbjct 2 KYLTFNKNNRDAIDLSEKLEATKIDLSNPLLLQYNWVIWEQVSDNKIK--QSNNYKDYTR 59 Query 135 DLASFDTVQ 143 LA F++VQ Sbjct 60 PLAKFNSVQ 68 > tpv:TP02_0735 translation initiation factor E4; K03259 translation initiation factor 4E Length=221 Score = 45.4 bits (106), Expect = 9e-05, Method: Compositional matrix adjust. Identities = 23/67 (34%), Positives = 36/67 (53%), Gaps = 3/67 (4%) Query 78 LSFNPSVADAVNLDECITEER-PADAPMPLQHRWHVWEQIQREAAAADRAADYSQNTRDL 136 L+FN + D L E D P+ L+++W +WEQI + + DY ++T+ L Sbjct 18 LTFNKNTEDHAKLSELFESTTINLDTPLSLKNKWVIWEQIVKMPEHSQN--DYKEHTKPL 75 Query 137 ASFDTVQ 143 SFD+VQ Sbjct 76 VSFDSVQ 82 > bbo:BBOV_III011150 17.m10646; translation initiation factor E4; K03259 translation initiation factor 4E Length=242 Score = 41.6 bits (96), Expect = 0.001, Method: Compositional matrix adjust. Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 2/67 (2%) Query 78 LSFNPSVADAVNLDECI-TEERPADAPMPLQHRWHVWEQIQREAAAADRAADYSQNTRDL 136 L+FN D + E T PMPL+++W +WEQI + + + DY T+ L Sbjct 22 LTFNKKSEDFKRVAELFETSNVDISTPMPLRNKWVIWEQIVK-GQDSRNSNDYKCYTKPL 80 Query 137 ASFDTVQ 143 SFD+VQ Sbjct 81 VSFDSVQ 87 > mmu:244958 Mrap2, BB633055; melanocortin 2 receptor accessory protein 2 Length=207 Score = 38.5 bits (88), Expect = 0.011, Method: Compositional matrix adjust. Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 0/48 (0%) Query 3 FFVFFPLVLVLKRSGPEQEGARAADARFRRSSFASSAGGVCCSSPLFA 50 F+FF L L+ K P Q+ A +++ RFR +SF S G S +F+ Sbjct 60 IFMFFVLTLLTKTGAPHQDNAESSERRFRMNSFVSDFGKPLESDKVFS 107 > hsa:112609 MRAP2, C6orf117, RP11-51G5.2, bA51G5.2; melanocortin 2 receptor accessory protein 2 Length=205 Score = 37.4 bits (85), Expect = 0.027, Method: Compositional matrix adjust. Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 0/38 (0%) Query 3 FFVFFPLVLVLKRSGPEQEGARAADARFRRSSFASSAG 40 F+FF L L+ K P Q+ A +++ RFR +SF S G Sbjct 58 IFMFFVLTLLTKTGAPHQDNAESSEKRFRMNSFVSDFG 95 > dre:550549 eif4e1c, eif4E-1C, fb57e09, wu:fb57e09, zgc:110154; eukaryotic translation initiation factor 4E family member 1c; K03259 translation initiation factor 4E Length=213 Score = 32.7 bits (73), Expect = 0.56, Method: Compositional matrix adjust. Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 19/63 (30%) Query 95 TEERPADAPM-------------PLQHRWHVWEQIQREAAAADRAADYSQNTRDLASFDT 141 TEE +D+P PLQ+RW +W D++ +++N R ++ FDT Sbjct 11 TEEVRSDSPTAVVTTSPEQYIKHPLQNRWALW------YFKNDKSKSWTENLRLISKFDT 64 Query 142 VQD 144 V+D Sbjct 65 VED 67 > dre:30738 eif4e1b, Z4ES, eif4e, zeIF4E; eukaryotic translation initiation factor 4e 1b Length=214 Score = 30.8 bits (68), Expect = 2.4, Method: Compositional matrix adjust. Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 6/40 (15%) Query 105 PLQHRWHVWEQIQREAAAADRAADYSQNTRDLASFDTVQD 144 PLQ+RW +W D++ + N R + FDTV+D Sbjct 35 PLQNRWGLW------FYKNDKSKMWQDNLRLITKFDTVED 68 > mmu:102098 Arhgef18, AI467246, D030053O22Rik; rho/rac guanine nucleotide exchange factor (GEF) 18 Length=1021 Score = 30.0 bits (66), Expect = 4.7, Method: Composition-based stats. Identities = 28/93 (30%), Positives = 37/93 (39%), Gaps = 16/93 (17%) Query 91 DECITEERPADAPMPLQ---------HRWHVWEQIQREAAAADRAADY-------SQNTR 134 D E RPA + +P+Q + V +QI + AA+ + SQ Sbjct 864 DSAPPESRPAKSDVPIQLLSATNQIQRQTAVQQQIPTKLAASTKGGKEKGSKSRGSQRWE 923 Query 135 DLASFDTVQDLGFRVFLLLRRSGSCGRTSPSPV 167 ASFD Q L F+ S S R S SPV Sbjct 924 SSASFDLKQQLLLSKFIGKDESASRNRRSLSPV 956 > hsa:1977 EIF4E, CBP, EIF4E1, EIF4EL1, EIF4F, MGC111573; eukaryotic translation initiation factor 4E; K03259 translation initiation factor 4E Length=237 Score = 29.6 bits (65), Expect = 4.8, Method: Compositional matrix adjust. Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 6/40 (15%) Query 105 PLQHRWHVWEQIQREAAAADRAADYSQNTRDLASFDTVQD 144 PLQ+RW +W D++ + N R ++ FDTV+D Sbjct 58 PLQNRWALW------FFKNDKSKTWQANLRLISKFDTVED 91 > xla:399255 eif4e, MGC84530; eIF-4E protein; K03259 translation initiation factor 4E Length=231 Score = 29.6 bits (65), Expect = 5.4, Method: Compositional matrix adjust. Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 6/40 (15%) Query 105 PLQHRWHVWEQIQREAAAADRAADYSQNTRDLASFDTVQD 144 PLQ+RW +W D++ + N R ++ FDTV+D Sbjct 52 PLQNRWALW------FFKNDKSKTWQANLRLISKFDTVED 85 > mmu:13684 Eif4e, EG668879, Eif4e-ps, If4e, MGC103177, eIF-4E; eukaryotic translation initiation factor 4E; K03259 translation initiation factor 4E Length=217 Score = 29.6 bits (65), Expect = 5.5, Method: Compositional matrix adjust. Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 6/40 (15%) Query 105 PLQHRWHVWEQIQREAAAADRAADYSQNTRDLASFDTVQD 144 PLQ+RW +W D++ + N R ++ FDTV+D Sbjct 38 PLQNRWALW------FFKNDKSKTWQANLRLISKFDTVED 71 > xla:734259 eif4e, MGC85107, eIF-4E, eif4e1; eukaryotic translation initiation factor 4E; K03259 translation initiation factor 4E Length=213 Score = 29.6 bits (65), Expect = 5.6, Method: Compositional matrix adjust. Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 6/40 (15%) Query 105 PLQHRWHVWEQIQREAAAADRAADYSQNTRDLASFDTVQD 144 PLQ+RW +W D++ + N R ++ FDTV+D Sbjct 34 PLQNRWALW------FFKNDKSKTWQANLRLISKFDTVED 67 > dre:100332201 eukaryotic translation initiation factor 4E-1A-like Length=215 Score = 29.6 bits (65), Expect = 5.8, Method: Compositional matrix adjust. Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 6/40 (15%) Query 105 PLQHRWHVWEQIQREAAAADRAADYSQNTRDLASFDTVQD 144 PLQ+RW +W D++ + N R ++ FDTV+D Sbjct 36 PLQNRWALW------FFKNDKSKTWQANLRLISKFDTVED 69 > tgo:TGME49_010780 ubiquitin carboxyl-terminal hydrolase, putative (EC:3.1.2.15) Length=4302 Score = 29.6 bits (65), Expect = 6.1, Method: Compositional matrix adjust. Identities = 21/76 (27%), Positives = 29/76 (38%), Gaps = 16/76 (21%) Query 66 CCCFWTMASTKYLSFNPSVADAVNLDECITEERPADAPMPLQHRWHV--WEQIQREAAAA 123 C CF ++ +LS I P D PM RWH WE + +A Sbjct 3669 CACFLSLRMEDFLS--------------IAHGNPLDGPMAETPRWHPAEWEAVLGNMESA 3714 Query 124 DRAADYSQNTRDLASF 139 D+SQ+ + AS Sbjct 3715 VLKIDFSQSLGNWASI 3730 > dre:79380 eif4e, eif4e-1, eif4e1a, zgc:86680; eukaryotic translation initiation factor 4e; K03259 translation initiation factor 4E Length=215 Score = 29.3 bits (64), Expect = 6.1, Method: Compositional matrix adjust. Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 6/40 (15%) Query 105 PLQHRWHVWEQIQREAAAADRAADYSQNTRDLASFDTVQD 144 PLQ+RW +W D++ + N R ++ FDTV+D Sbjct 36 PLQNRWALW------FFKNDKSKTWQANLRLISKFDTVED 69 > dre:493617 zgc:101581 Length=216 Score = 29.3 bits (64), Expect = 7.9, Method: Compositional matrix adjust. Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 6/40 (15%) Query 105 PLQHRWHVWEQIQREAAAADRAADYSQNTRDLASFDTVQD 144 PLQ+RW +W D++ + N R ++ FDTV+D Sbjct 37 PLQNRWCLW------FFKNDKSKTWQANLRLISKFDTVED 70 Lambda K H 0.325 0.135 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 4471152252 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40