bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_3958_orf1 Length=184 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_060440 46 kDa FK506-binding nuclear protein, putati... 65.1 1e-10 cpv:cgd2_200 hypothetical protein ; K11276 nucleophosmin 1 33.1 > tgo:TGME49_060440 46 kDa FK506-binding nuclear protein, putative (EC:5.2.1.8); K11276 nucleophosmin 1 Length=311 Score = 65.1 bits (157), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 33/47 (70%), Positives = 39/47 (82%), Gaps = 1/47 (2%) Query 119 GDEASYRNALGDFLKKNEPTPLASLGQKVKKPASLP-KMAAFLKANS 164 GD A+Y++AL DFLKKN TPLA+LGQKVKKPA + KMA FLKAN+ Sbjct 252 GDAAAYKSALVDFLKKNGKTPLATLGQKVKKPAGVSEKMAQFLKANA 298 > cpv:cgd2_200 hypothetical protein ; K11276 nucleophosmin 1 Length=323 Score = 33.1 bits (74), Expect = 0.58, Method: Compositional matrix adjust. Identities = 18/54 (33%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Query 116 SSSGDEASYRNALGDFLKKNEPTPLASLGQKVKKPASLP-KMAAFLKANSDKLR 168 S S + Y ++ DFLKKN T +A +G K+K+P + K+ +F+ +D + Sbjct 260 SQSKPDQLYEESIIDFLKKNGRTNMAMIGNKIKRPEGVSKKLGSFIAERTDLFK 313 Lambda K H 0.312 0.129 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 5041515336 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40