bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_4330_orf3 Length=102 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_109820 ribosomal protein L11, putative ; K02868 lar... 89.0 4e-18 xla:447109 rpl11, MGC85310; ribosomal protein L11; K02868 larg... 80.9 9e-16 mmu:67025 Rpl11, 2010203J19Rik; ribosomal protein L11; K02868 ... 80.5 1e-15 hsa:6135 RPL11, DBA7, GIG34; ribosomal protein L11; K02868 lar... 80.5 1e-15 dre:415229 rpl11, zgc:86748; ribosomal protein L11; K02868 lar... 80.1 1e-15 sce:YPR102C RPL11A; Rpl11ap; K02868 large subunit ribosomal pr... 80.1 2e-15 mmu:100040540 Gm10288; ribosomal protein L11 pseudogene 79.7 2e-15 sce:YGR085C RPL11B; Rpl11bp; K02868 large subunit ribosomal pr... 79.7 2e-15 mmu:100040551 Gm10036; predicted gene 10036 78.6 cel:F07D10.1 rpl-11.2; Ribosomal Protein, Large subunit family... 76.6 2e-14 tpv:TP01_0352 60S ribosomal protein L11a; K02868 large subunit... 75.9 3e-14 cel:T22F3.4 rpl-11.1; Ribosomal Protein, Large subunit family ... 75.9 3e-14 bbo:BBOV_IV005460 23.m05801; 60S ribosomal protein L11; K02868... 75.5 4e-14 cpv:cgd6_2170 60S ribosomal protein L11 ; K02868 large subunit... 71.2 7e-13 ath:AT2G42740 RPL16A; RPL16A; structural constituent of ribosome 71.2 8e-13 ath:AT3G58700 60S ribosomal protein L11 (RPL11B) 71.2 8e-13 ath:AT4G18730 RPL16B; RPL16B; structural constituent of ribosome 71.2 8e-13 ath:AT5G45775 60S ribosomal protein L11 (RPL11D) 71.2 8e-13 mmu:328825 Gm5093, EG328825; predicted gene 5093 70.5 mmu:665330 Gm7589, EG665330; predicted gene 7589 70.5 pfa:PF07_0079 60S ribosomal protein L11a, putative; K02868 lar... 70.1 2e-12 mmu:100041864 Gm3552; predicted gene 3552 44.3 hsa:25959 KANK2, ANKRD25, DKFZp434N161, FLJ20004, KIAA1518, MG... 29.6 2.7 > tgo:TGME49_109820 ribosomal protein L11, putative ; K02868 large subunit ribosomal protein L11e Length=175 Score = 89.0 bits (219), Expect = 4e-18, Method: Compositional matrix adjust. Identities = 46/78 (58%), Positives = 52/78 (66%), Gaps = 0/78 (0%) Query 25 EERPTRKNRSEKRTTNNGAGETGDRPTRAAREPEQRTGQRPAQTRARKTSRTDSKRRNEK 84 EE P RK R EK T N GE+GDR TRAAR EQ TGQRP ++AR T R+ RRNEK Sbjct 6 EENPMRKIRIEKLTLNICVGESGDRLTRAARVLEQLTGQRPQFSKARFTIRSFGIRRNEK 65 Query 85 NARHETARGKKAEETEEK 102 A + T RGKKAE+ EK Sbjct 66 IACYVTVRGKKAEDILEK 83 > xla:447109 rpl11, MGC85310; ribosomal protein L11; K02868 large subunit ribosomal protein L11e Length=177 Score = 80.9 bits (198), Expect = 9e-16, Method: Compositional matrix adjust. Identities = 42/82 (51%), Positives = 50/82 (60%), Gaps = 0/82 (0%) Query 21 EKATEERPTRKNRSEKRTTNNGAGETGDRPTRAAREPEQRTGQRPAQTRARKTSRTDSKR 80 +K +E P R+ R K N GE+GDR TRAA+ EQ TGQ P ++AR T R+ R Sbjct 3 DKTEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIR 62 Query 81 RNEKNARHETARGKKAEETEEK 102 RNEK A H T RG KAEE EK Sbjct 63 RNEKIAVHCTVRGAKAEEILEK 84 > mmu:67025 Rpl11, 2010203J19Rik; ribosomal protein L11; K02868 large subunit ribosomal protein L11e Length=178 Score = 80.5 bits (197), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 41/77 (53%), Positives = 47/77 (61%), Gaps = 0/77 (0%) Query 26 ERPTRKNRSEKRTTNNGAGETGDRPTRAAREPEQRTGQRPAQTRARKTSRTDSKRRNEKN 85 E P R+ R K N GE+GDR TRAA+ EQ TGQ P ++AR T R+ RRNEK Sbjct 9 ENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRRNEKI 68 Query 86 ARHETARGKKAEETEEK 102 A H T RG KAEE EK Sbjct 69 AVHCTVRGAKAEEILEK 85 > hsa:6135 RPL11, DBA7, GIG34; ribosomal protein L11; K02868 large subunit ribosomal protein L11e Length=178 Score = 80.5 bits (197), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 41/77 (53%), Positives = 47/77 (61%), Gaps = 0/77 (0%) Query 26 ERPTRKNRSEKRTTNNGAGETGDRPTRAAREPEQRTGQRPAQTRARKTSRTDSKRRNEKN 85 E P R+ R K N GE+GDR TRAA+ EQ TGQ P ++AR T R+ RRNEK Sbjct 9 ENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRRNEKI 68 Query 86 ARHETARGKKAEETEEK 102 A H T RG KAEE EK Sbjct 69 AVHCTVRGAKAEEILEK 85 > dre:415229 rpl11, zgc:86748; ribosomal protein L11; K02868 large subunit ribosomal protein L11e Length=178 Score = 80.1 bits (196), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 41/77 (53%), Positives = 47/77 (61%), Gaps = 0/77 (0%) Query 26 ERPTRKNRSEKRTTNNGAGETGDRPTRAAREPEQRTGQRPAQTRARKTSRTDSKRRNEKN 85 E P R+ R K N GE+GDR TRAA+ EQ TGQ P ++AR T R+ RRNEK Sbjct 9 ENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRRNEKI 68 Query 86 ARHETARGKKAEETEEK 102 A H T RG KAEE EK Sbjct 69 AVHCTVRGAKAEEILEK 85 > sce:YPR102C RPL11A; Rpl11ap; K02868 large subunit ribosomal protein L11e Length=174 Score = 80.1 bits (196), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 40/80 (50%), Positives = 49/80 (61%), Gaps = 0/80 (0%) Query 23 ATEERPTRKNRSEKRTTNNGAGETGDRPTRAAREPEQRTGQRPAQTRARKTSRTDSKRRN 82 A + P R + EK N GE+GDR TRA++ EQ +GQ P Q++AR T RT RRN Sbjct 3 AKAQNPMRDLKIEKLVLNISVGESGDRLTRASKVLEQLSGQTPVQSKARYTVRTFGIRRN 62 Query 83 EKNARHETARGKKAEETEEK 102 EK A H T RG KAEE E+ Sbjct 63 EKIAVHVTVRGPKAEEILER 82 > mmu:100040540 Gm10288; ribosomal protein L11 pseudogene Length=178 Score = 79.7 bits (195), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 41/77 (53%), Positives = 46/77 (59%), Gaps = 0/77 (0%) Query 26 ERPTRKNRSEKRTTNNGAGETGDRPTRAAREPEQRTGQRPAQTRARKTSRTDSKRRNEKN 85 E P R+ R K N GE GDR TRAA+ EQ TGQ P ++AR T R+ RRNEK Sbjct 9 ENPMRELRIRKLCLNICVGENGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRRNEKI 68 Query 86 ARHETARGKKAEETEEK 102 A H T RG KAEE EK Sbjct 69 AVHCTVRGAKAEEILEK 85 > sce:YGR085C RPL11B; Rpl11bp; K02868 large subunit ribosomal protein L11e Length=174 Score = 79.7 bits (195), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 39/75 (52%), Positives = 47/75 (62%), Gaps = 0/75 (0%) Query 28 PTRKNRSEKRTTNNGAGETGDRPTRAAREPEQRTGQRPAQTRARKTSRTDSKRRNEKNAR 87 P R + EK N GE+GDR TRA++ EQ +GQ P Q++AR T RT RRNEK A Sbjct 8 PMRDLKIEKLVLNISVGESGDRLTRASKVLEQLSGQTPVQSKARYTVRTFGIRRNEKIAV 67 Query 88 HETARGKKAEETEEK 102 H T RG KAEE E+ Sbjct 68 HVTVRGPKAEEILER 82 > mmu:100040551 Gm10036; predicted gene 10036 Length=178 Score = 78.6 bits (192), Expect = 5e-15, Method: Compositional matrix adjust. Identities = 40/77 (51%), Positives = 46/77 (59%), Gaps = 0/77 (0%) Query 26 ERPTRKNRSEKRTTNNGAGETGDRPTRAAREPEQRTGQRPAQTRARKTSRTDSKRRNEKN 85 E P R+ R K N GE+GDR TRAA+ EQ TGQ P ++AR T R+ RNEK Sbjct 9 ENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIWRNEKI 68 Query 86 ARHETARGKKAEETEEK 102 A H T RG KAEE EK Sbjct 69 AVHCTVRGAKAEEILEK 85 > cel:F07D10.1 rpl-11.2; Ribosomal Protein, Large subunit family member (rpl-11.2); K02868 large subunit ribosomal protein L11e Length=196 Score = 76.6 bits (187), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 45/91 (49%), Positives = 52/91 (57%), Gaps = 6/91 (6%) Query 18 GKKEKATEER------PTRKNRSEKRTTNNGAGETGDRPTRAAREPEQRTGQRPAQTRAR 71 G EK TE R R+ + +K N GE+GDR TRAA+ EQ TGQ P ++AR Sbjct 2 GDIEKQTEIREKKARNVMRELKIQKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKAR 61 Query 72 KTSRTDSKRRNEKNARHETARGKKAEETEEK 102 T RT RRNEK A H T RG KAEE EK Sbjct 62 YTVRTFGIRRNEKIAVHCTVRGPKAEEILEK 92 > tpv:TP01_0352 60S ribosomal protein L11a; K02868 large subunit ribosomal protein L11e Length=171 Score = 75.9 bits (185), Expect = 3e-14, Method: Compositional matrix adjust. Identities = 37/80 (46%), Positives = 46/80 (57%), Gaps = 0/80 (0%) Query 23 ATEERPTRKNRSEKRTTNNGAGETGDRPTRAAREPEQRTGQRPAQTRARKTSRTDSKRRN 82 TE P R R K N G GE+GDR TRA + EQ T Q+P ++ R T R+ RRN Sbjct 1 MTEPNPMRDIRINKLVLNIGVGESGDRLTRAGKVLEQLTDQKPVFSKCRFTIRSLGVRRN 60 Query 83 EKNARHETARGKKAEETEEK 102 EK A H T RG+KA + E+ Sbjct 61 EKIACHVTVRGQKALDILER 80 > cel:T22F3.4 rpl-11.1; Ribosomal Protein, Large subunit family member (rpl-11.1); K02868 large subunit ribosomal protein L11e Length=196 Score = 75.9 bits (185), Expect = 3e-14, Method: Compositional matrix adjust. Identities = 44/88 (50%), Positives = 51/88 (57%), Gaps = 6/88 (6%) Query 21 EKATEER------PTRKNRSEKRTTNNGAGETGDRPTRAAREPEQRTGQRPAQTRARKTS 74 EK TE R R+ + +K N GE+GDR TRAA+ EQ TGQ P ++AR T Sbjct 5 EKQTEIREKKGRNVMRELKIQKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTV 64 Query 75 RTDSKRRNEKNARHETARGKKAEETEEK 102 RT RRNEK A H T RG KAEE EK Sbjct 65 RTFGIRRNEKIAVHCTVRGPKAEEILEK 92 > bbo:BBOV_IV005460 23.m05801; 60S ribosomal protein L11; K02868 large subunit ribosomal protein L11e Length=171 Score = 75.5 bits (184), Expect = 4e-14, Method: Compositional matrix adjust. Identities = 37/80 (46%), Positives = 46/80 (57%), Gaps = 0/80 (0%) Query 23 ATEERPTRKNRSEKRTTNNGAGETGDRPTRAAREPEQRTGQRPAQTRARKTSRTDSKRRN 82 T+E R + K N G GE+GDR TRA + EQ T Q+P ++ R T R+ RRN Sbjct 1 MTQENVMRDIQIAKLVLNVGVGESGDRLTRAGKVLEQLTDQKPVFSKCRFTIRSLGVRRN 60 Query 83 EKNARHETARGKKAEETEEK 102 EK A H T RGKKA E E+ Sbjct 61 EKIACHVTVRGKKALELLER 80 > cpv:cgd6_2170 60S ribosomal protein L11 ; K02868 large subunit ribosomal protein L11e Length=172 Score = 71.2 bits (173), Expect = 7e-13, Method: Compositional matrix adjust. Identities = 36/78 (46%), Positives = 46/78 (58%), Gaps = 0/78 (0%) Query 25 EERPTRKNRSEKRTTNNGAGETGDRPTRAAREPEQRTGQRPAQTRARKTSRTDSKRRNEK 84 E P + + EK N G++GDR TRAA+ EQ T Q+P +AR T R+ S RR EK Sbjct 4 EVNPMKNIKIEKLVINISVGQSGDRLTRAAKVLEQLTDQKPVFGQARFTIRSFSIRRAEK 63 Query 85 NARHETARGKKAEETEEK 102 + + T RG KAEE EK Sbjct 64 ISCYVTVRGDKAEEILEK 81 > ath:AT2G42740 RPL16A; RPL16A; structural constituent of ribosome Length=182 Score = 71.2 bits (173), Expect = 8e-13, Method: Compositional matrix adjust. Identities = 33/74 (44%), Positives = 45/74 (60%), Gaps = 0/74 (0%) Query 28 PTRKNRSEKRTTNNGAGETGDRPTRAAREPEQRTGQRPAQTRARKTSRTDSKRRNEKNAR 87 P R + +K N GE+GDR TRA++ EQ +GQ P ++AR T R+ RRNEK A Sbjct 10 PMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIAC 69 Query 88 HETARGKKAEETEE 101 + T RG+KA + E Sbjct 70 YVTVRGEKAMQLLE 83 > ath:AT3G58700 60S ribosomal protein L11 (RPL11B) Length=182 Score = 71.2 bits (173), Expect = 8e-13, Method: Compositional matrix adjust. Identities = 33/74 (44%), Positives = 45/74 (60%), Gaps = 0/74 (0%) Query 28 PTRKNRSEKRTTNNGAGETGDRPTRAAREPEQRTGQRPAQTRARKTSRTDSKRRNEKNAR 87 P R + +K N GE+GDR TRA++ EQ +GQ P ++AR T R+ RRNEK A Sbjct 10 PMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIAC 69 Query 88 HETARGKKAEETEE 101 + T RG+KA + E Sbjct 70 YVTVRGEKAMQLLE 83 > ath:AT4G18730 RPL16B; RPL16B; structural constituent of ribosome Length=182 Score = 71.2 bits (173), Expect = 8e-13, Method: Compositional matrix adjust. Identities = 33/74 (44%), Positives = 45/74 (60%), Gaps = 0/74 (0%) Query 28 PTRKNRSEKRTTNNGAGETGDRPTRAAREPEQRTGQRPAQTRARKTSRTDSKRRNEKNAR 87 P R + +K N GE+GDR TRA++ EQ +GQ P ++AR T R+ RRNEK A Sbjct 10 PMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIAC 69 Query 88 HETARGKKAEETEE 101 + T RG+KA + E Sbjct 70 YVTVRGEKAMQLLE 83 > ath:AT5G45775 60S ribosomal protein L11 (RPL11D) Length=182 Score = 71.2 bits (173), Expect = 8e-13, Method: Compositional matrix adjust. Identities = 33/74 (44%), Positives = 45/74 (60%), Gaps = 0/74 (0%) Query 28 PTRKNRSEKRTTNNGAGETGDRPTRAAREPEQRTGQRPAQTRARKTSRTDSKRRNEKNAR 87 P R + +K N GE+GDR TRA++ EQ +GQ P ++AR T R+ RRNEK A Sbjct 10 PMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIAC 69 Query 88 HETARGKKAEETEE 101 + T RG+KA + E Sbjct 70 YVTVRGEKAMQLLE 83 > mmu:328825 Gm5093, EG328825; predicted gene 5093 Length=198 Score = 70.5 bits (171), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 39/77 (50%), Positives = 44/77 (57%), Gaps = 4/77 (5%) Query 26 ERPTRKNRSEKRTTNNGAGETGDRPTRAAREPEQRTGQRPAQTRARKTSRTDSKRRNEKN 85 E P R+ R K N GDR TRAA+ EQ TGQ P ++AR T R+ RRNEK Sbjct 9 ENPLREPRIRKLCLNI----CGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRRNEKI 64 Query 86 ARHETARGKKAEETEEK 102 A H T RG KAEE EK Sbjct 65 AVHCTVRGAKAEEILEK 81 > mmu:665330 Gm7589, EG665330; predicted gene 7589 Length=178 Score = 70.5 bits (171), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 38/77 (49%), Positives = 44/77 (57%), Gaps = 0/77 (0%) Query 26 ERPTRKNRSEKRTTNNGAGETGDRPTRAAREPEQRTGQRPAQTRARKTSRTDSKRRNEKN 85 E R+ R K N GE+ DR TRAA+ EQ TGQ ++AR T R+ RRNEK Sbjct 9 ENLMRELRIRKLCLNICIGESRDRLTRAAKVLEQLTGQTLVFSKARYTVRSFGIRRNEKI 68 Query 86 ARHETARGKKAEETEEK 102 A H T RG KAEE EK Sbjct 69 AVHCTVRGAKAEEILEK 85 > pfa:PF07_0079 60S ribosomal protein L11a, putative; K02868 large subunit ribosomal protein L11e Length=173 Score = 70.1 bits (170), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 36/78 (46%), Positives = 44/78 (56%), Gaps = 0/78 (0%) Query 25 EERPTRKNRSEKRTTNNGAGETGDRPTRAAREPEQRTGQRPAQTRARKTSRTDSKRRNEK 84 E+ R+ + K N GE+GDR TRAAR EQ T Q+P + R T R+ RRNEK Sbjct 5 EQNVMREIKVNKLVLNICVGESGDRLTRAARVLEQLTEQKPIFGKCRFTIRSFGVRRNEK 64 Query 85 NARHETARGKKAEETEEK 102 + T RGKKA E EK Sbjct 65 ISCFVTVRGKKALEILEK 82 > mmu:100041864 Gm3552; predicted gene 3552 Length=221 Score = 44.3 bits (103), Expect = 9e-05, Method: Compositional matrix adjust. Identities = 30/59 (50%), Positives = 32/59 (54%), Gaps = 8/59 (13%) Query 51 TRAAREPEQRTGQR-------PAQTRARKTSRTDSKRRNEKNARHETARGKKAEETEEK 102 R AR P RTG+R TRAR T R+ RRNEK A H T RG KAEE EK Sbjct 44 LRRARHP-VRTGERRRIAAKDKYGTRARYTVRSFGIRRNEKIAVHCTVRGAKAEEILEK 101 > hsa:25959 KANK2, ANKRD25, DKFZp434N161, FLJ20004, KIAA1518, MGC119707, MXRA3, SIP; KN motif and ankyrin repeat domains 2 Length=851 Score = 29.6 bits (65), Expect = 2.7, Method: Compositional matrix adjust. Identities = 29/85 (34%), Positives = 40/85 (47%), Gaps = 5/85 (5%) Query 17 DGKKEKATEERPTRKNRSEKRTTNNGAGETGDRPTRAAREPEQRTGQRPAQTRARKTSRT 76 +G E ++E+ T +N S+ +T N A E +R A P+ R PA T A KTSR Sbjct 505 NGGYESSSEDSSTAENISDNDSTENEAPEPRERVPSVAEAPQLR----PAGTAAAKTSRQ 560 Query 77 DSKRRNEKNARHETARGKKAEETEE 101 + + E TA G TEE Sbjct 561 ECQLSRESQ-HIPTAEGASGSNTEE 584 Lambda K H 0.297 0.114 0.301 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2031832220 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40