bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_4527_orf3 Length=133 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_060630 DnaJ domain-containing protein ; K09540 tran... 144 5e-35 pfa:PF13_0102 DnaJ/SEC63 protein, putative; K09540 translocati... 99.8 2e-21 cpv:cgd7_3880 DNAJ domain protein sec63 ortholog, 4 transmembr... 67.4 1e-11 bbo:BBOV_II005390 18.m06448; DnaJ domain containing protein; K... 53.9 1e-07 tpv:TP02_0490 hypothetical protein; K09540 translocation prote... 50.1 2e-06 mmu:16424 Itih1, Intin1, Itih-1; inter-alpha trypsin inhibitor... 33.9 0.13 cel:Y46G5A.4 hypothetical protein; K12854 pre-mRNA-splicing he... 32.0 0.56 ath:AT1G20960 emb1507 (embryo defective 1507); ATP binding / A... 30.4 1.6 cpv:cgd1_2570 alpha beta hydrolase 30.0 2.0 dre:567621 tiam1; T-cell lymphoma invasion and metastasis 1; K... 30.0 2.1 sce:YDL070W BDF2; Bdf2p; K11684 bromodomain-containing factor 1 29.3 eco:b4399 creC, ECK4391, JW4362, phoM; sensory histidine kinas... 28.9 4.1 tgo:TGME49_033080 tuftelin interacting protein 11, putative (E... 28.9 4.3 hsa:9662 CEP135, CEP4, KIAA0635; centrosomal protein 135kDa 28.9 5.0 ath:AT5G27930 protein phosphatase 2C, putative / PP2C, putative 28.5 5.6 ath:AT5G08060 hypothetical protein 27.7 8.9 xla:398575 klhl25, Xencr-2, encr-2; kelch-like 25; K10462 kelc... 27.7 8.9 > tgo:TGME49_060630 DnaJ domain-containing protein ; K09540 translocation protein SEC63 Length=675 Score = 144 bits (364), Expect = 5e-35, Method: Compositional matrix adjust. Identities = 70/115 (60%), Positives = 88/115 (76%), Gaps = 1/115 (0%) Query 1 KSRNLERVVKESLQFRVGRPGKNVMTVVALCDSYTGVDATIDVEFRAYTPEEKPREVFVH 60 +S++ ERVV+E +QFRV R GK +TV+A+CDSY G D T+++EF+AY PEEKPR V++H Sbjct 525 RSKSAERVVEERIQFRVNRVGKQSVTVLAICDSYAGCDCTMELEFKAYHPEEKPRPVWIH 584 Query 61 PEDVKLDEEPTLFQQMLGDMCVNSSDEEEEFDLDEAPKVVRKKVATENDGVATAE 115 PED++LDEEPTLFQQMLG+M SSDEEE FDLDE +V KK E A AE Sbjct 585 PEDLRLDEEPTLFQQMLGEM-YTSSDEEESFDLDEGLRVAVKKKTQEAGEAANAE 638 > pfa:PF13_0102 DnaJ/SEC63 protein, putative; K09540 translocation protein SEC63 Length=651 Score = 99.8 bits (247), Expect = 2e-21, Method: Composition-based stats. Identities = 43/78 (55%), Positives = 59/78 (75%), Gaps = 0/78 (0%) Query 3 RNLERVVKESLQFRVGRPGKNVMTVVALCDSYTGVDATIDVEFRAYTPEEKPREVFVHPE 62 +N E++++E LQF V + G ++V ALCDSY G D +D+ F+AY+ E RE+FVHPE Sbjct 521 KNCEKIIEEKLQFLVDKVGNLSVSVFALCDSYFGCDQKVDIPFKAYSKTEIKREIFVHPE 580 Query 63 DVKLDEEPTLFQQMLGDM 80 D++LD EPTLFQQMLGD+ Sbjct 581 DIELDNEPTLFQQMLGDI 598 > cpv:cgd7_3880 DNAJ domain protein sec63 ortholog, 4 transmembrane domains ; K09540 translocation protein SEC63 Length=627 Score = 67.4 bits (163), Expect = 1e-11, Method: Composition-based stats. Identities = 30/75 (40%), Positives = 48/75 (64%), Gaps = 0/75 (0%) Query 6 ERVVKESLQFRVGRPGKNVMTVVALCDSYTGVDATIDVEFRAYTPEEKPREVFVHPEDVK 65 E++V +QF + PG +++ + DSY G+D ++V F A T +E R+++VHPED Sbjct 529 EKIVDVKIQFLIETPGSIDISLHLINDSYEGLDQVVNVSFVAKTIKEGIRQIYVHPEDEA 588 Query 66 LDEEPTLFQQMLGDM 80 LD EPTLFQ ++ + Sbjct 589 LDNEPTLFQHIMNQL 603 > bbo:BBOV_II005390 18.m06448; DnaJ domain containing protein; K09540 translocation protein SEC63 Length=618 Score = 53.9 bits (128), Expect = 1e-07, Method: Composition-based stats. Identities = 28/89 (31%), Positives = 46/89 (51%), Gaps = 1/89 (1%) Query 7 RVVKESLQFRVGRPGKNVMTVVALCDSYTGVDATIDVEFRAYTPEEKPREVFVHPEDVKL 66 RV+ E + G + + V A+ DSY G D + VEF + + +HP+D+ L Sbjct 531 RVITEKISVLAENVGMHSVLVTAMSDSYFGCDKSTRVEFMVNMANDA-LDFKIHPDDIAL 589 Query 67 DEEPTLFQQMLGDMCVNSSDEEEEFDLDE 95 D EP+ +M+GD+ E+EE +D+ Sbjct 590 DNEPSAIGKMIGDLLRQEDSEDEEEVIDD 618 > tpv:TP02_0490 hypothetical protein; K09540 translocation protein SEC63 Length=659 Score = 50.1 bits (118), Expect = 2e-06, Method: Composition-based stats. Identities = 29/92 (31%), Positives = 49/92 (53%), Gaps = 2/92 (2%) Query 6 ERVVKESLQFRVGRPGKNVMTVVALCDSYTGVDATIDVEF--RAYTPEEKPREVFVHPED 63 E V E +Q + G+N + V A+ DSY G + ++ +F ++K +HPED Sbjct 568 EAEVVEKMQILAEKVGQNTICVTAVNDSYFGAEFSVLKKFYVNPLNLQKKYESFKIHPED 627 Query 64 VKLDEEPTLFQQMLGDMCVNSSDEEEEFDLDE 95 +KLDE+ +M+G++ S +EEE + E Sbjct 628 MKLDEDVNPITKMIGELLTAESSDEEEVEYIE 659 > mmu:16424 Itih1, Intin1, Itih-1; inter-alpha trypsin inhibitor, heavy chain 1 Length=907 Score = 33.9 bits (76), Expect = 0.13, Method: Compositional matrix adjust. Identities = 39/144 (27%), Positives = 58/144 (40%), Gaps = 27/144 (18%) Query 7 RVVKESLQFRVGRPGKNVMTVVALCDSYTGVDATIDVEFRAYTPEEK--PREVFV----- 59 +V+K SL + P + +T+ L D G++ TID P E PR FV Sbjct 589 QVLKMSLDYHFVTPLTS-LTIRGLTDE-DGLEPTIDKPLEDSQPLEMVGPRRTFVLSAIQ 646 Query 60 -----HPEDVKL-------DEEPTLFQQMLGDMCVNSSDEEEEFDLDEAPKVVRKKVATE 107 HP D KL D +P + V S ++ F+++E P V+ V Sbjct 647 PSPTAHPIDSKLPLRVTGVDTDPHFI------IYVPSKEDSLCFNINEEPGVILNLVQDP 700 Query 108 NDGVATAEQADSNKAGESGERPTT 131 + G Q NKA G+ +T Sbjct 701 DTGFTVNGQLIGNKASSPGQHEST 724 > cel:Y46G5A.4 hypothetical protein; K12854 pre-mRNA-splicing helicase BRR2 [EC:3.6.4.13] Length=2145 Score = 32.0 bits (71), Expect = 0.56, Method: Compositional matrix adjust. Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 0/44 (0%) Query 13 LQFRVGRPGKNVMTVVALCDSYTGVDATIDVEFRAYTPEEKPRE 56 L F RPG + + + DSY G D DV F+ P R+ Sbjct 2094 LDFAAPRPGHHKFKLFFISDSYLGADQEFDVAFKVEEPGRSNRK 2137 > ath:AT1G20960 emb1507 (embryo defective 1507); ATP binding / ATP-dependent helicase/ helicase/ nucleic acid binding / nucleoside-triphosphatase/ nucleotide binding; K12854 pre-mRNA-splicing helicase BRR2 [EC:3.6.4.13] Length=2171 Score = 30.4 bits (67), Expect = 1.6, Method: Compositional matrix adjust. Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Query 1 KSRNLERVVKESLQFRV-GRPGKNVMTVVALCDSYTGVD 38 K +L+R VK L F PG+ T+ +CDSY G D Sbjct 2113 KRVSLQRKVKVKLDFTAPSEPGEKSYTLYFMCDSYLGCD 2151 > cpv:cgd1_2570 alpha beta hydrolase Length=1448 Score = 30.0 bits (66), Expect = 2.0, Method: Composition-based stats. Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 2/65 (3%) Query 52 EKPREVFVHPEDVKLDEEPTLFQQMLGDMCVNSSDEEEEFDLDEAPKVVRKKVATENDGV 111 EK E+ D L+ P +F M D +N S + +EF+ +E P+V K+ +D + Sbjct 941 EKTNELIHSTSDNVLETIP-IFGNMGFDQ-INQSADTDEFNYEEIPEVDSNKIEKLHDEI 998 Query 112 ATAEQ 116 + EQ Sbjct 999 ESPEQ 1003 > dre:567621 tiam1; T-cell lymphoma invasion and metastasis 1; K05731 T-cell lymphoma invasion and metastasis Length=1684 Score = 30.0 bits (66), Expect = 2.1, Method: Compositional matrix adjust. Identities = 25/93 (26%), Positives = 41/93 (44%), Gaps = 15/93 (16%) Query 29 ALCDSYTGV-----DATIDVEFRAYTPEEKPR-------EVFVHPEDVKLDEEPTLFQQM 76 A C S+T V A D EF+A+ E PR E ++ ++ + P L +++ Sbjct 1226 AFCASHTKVPKVLTKAKTDPEFKAFLAERNPRQQHSSTLESYLIKPIQRVLKYPLLLREL 1285 Query 77 LGDMCVNSSDEEEEFDLDEAPKVVRKKVATEND 109 + D EE + LD A K + K + N+ Sbjct 1286 YS---LTDPDSEEHYHLDVAMKAMNKVASHINE 1315 > sce:YDL070W BDF2; Bdf2p; K11684 bromodomain-containing factor 1 Length=638 Score = 29.3 bits (64), Expect = 3.1, Method: Composition-based stats. Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 5/49 (10%) Query 84 SSDEEEEFDLDEAPKVVRKKVATENDGVATAEQADSNKAGESGERPTTT 132 S + ++ D+D +P V+R+ V+T ND + + N+ G SG RP T Sbjct 253 SRNRKKNEDMD-SPLVIRRSVSTTNDNIGES----GNREGVSGGRPKRT 296 > eco:b4399 creC, ECK4391, JW4362, phoM; sensory histidine kinase in two-component regulatory system with CreB or PhoB, regulator of the CreBC regulon; K07641 two-component system, OmpR family, sensor histidine kinase CreC [EC:2.7.13.3] Length=474 Score = 28.9 bits (63), Expect = 4.1, Method: Composition-based stats. Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 0/43 (0%) Query 44 EFRAYTPEEKPREVFVHPEDVKLDEEPTLFQQMLGDMCVNSSD 86 E R EK + V P +V + EP L +Q LG++ N+ D Sbjct 339 EARTVQLAEKKITLHVTPTEVNVAAEPALLEQALGNLLDNAID 381 > tgo:TGME49_033080 tuftelin interacting protein 11, putative (EC:3.4.21.72); K13103 tuftelin-interacting protein 11 Length=1415 Score = 28.9 bits (63), Expect = 4.3, Method: Compositional matrix adjust. Identities = 17/38 (44%), Positives = 24/38 (63%), Gaps = 1/38 (2%) Query 72 LFQQMLGDMCVNSSDEEEEFDLDEAPKVVRKKVATEND 109 + +++LGD SS+EEE+ DLDE + K A END Sbjct 119 VLKEVLGD-AYESSEEEEKADLDEEKEKASAKSAEEND 155 > hsa:9662 CEP135, CEP4, KIAA0635; centrosomal protein 135kDa Length=1140 Score = 28.9 bits (63), Expect = 5.0, Method: Compositional matrix adjust. Identities = 21/85 (24%), Positives = 40/85 (47%), Gaps = 0/85 (0%) Query 46 RAYTPEEKPREVFVHPEDVKLDEEPTLFQQMLGDMCVNSSDEEEEFDLDEAPKVVRKKVA 105 R +E RE H E+V L + L + + CVN E E+++L ++++ + Sbjct 580 RIMAEKEALREKLEHIEEVSLFGKSELEKTIEHLTCVNHQLESEKYELKSKVLIMKETIE 639 Query 106 TENDGVATAEQADSNKAGESGERPT 130 + + + Q S+ AG+S + T Sbjct 640 SLENKLKVQAQKFSHVAGDSSHQKT 664 > ath:AT5G27930 protein phosphatase 2C, putative / PP2C, putative Length=373 Score = 28.5 bits (62), Expect = 5.6, Method: Compositional matrix adjust. Identities = 22/96 (22%), Positives = 40/96 (41%), Gaps = 22/96 (22%) Query 33 SYTGVDATIDVEFRAYTPEEKPREVFVHPEDVKLDEEPTL--------------FQQMLG 78 S V T+D F+ P+EK R + LD+EP + + G Sbjct 210 SLVAVQLTLD--FKPNLPQEKERIIGCKGRVFCLDDEPGVHRVWQPDAETPGLAMSRAFG 267 Query 79 DMCVNSSDEEEEFDLDEAPKVVRKKVATENDGVATA 114 D C+ +E+ L P+V ++ ++T++ + A Sbjct 268 DYCI------KEYGLVSVPEVTQRHISTKDHFIILA 297 > ath:AT5G08060 hypothetical protein Length=131 Score = 27.7 bits (60), Expect = 8.9, Method: Compositional matrix adjust. Identities = 27/101 (26%), Positives = 40/101 (39%), Gaps = 6/101 (5%) Query 3 RNLERVVKESLQFRVGRPGKNVMTVVALCDSY-TGVDATIDVEFRAYTPEEKPREVF--- 58 +NL R +K+ Q + V Y ATID E A P P V+ Sbjct 14 QNLRRYIKKPWQITGPCAHPEYLEAVPKATEYRLRCPATIDEE--AIVPSSDPETVYNIV 71 Query 59 VHPEDVKLDEEPTLFQQMLGDMCVNSSDEEEEFDLDEAPKV 99 H D + + P + D V +E++ FD+ + PKV Sbjct 72 YHGRDQRRNRPPIRRYVLTKDNVVQMMNEKKSFDVSDFPKV 112 > xla:398575 klhl25, Xencr-2, encr-2; kelch-like 25; K10462 kelch-like protein 25/37 (ectoderm-neural cortex protein) Length=589 Score = 27.7 bits (60), Expect = 8.9, Method: Composition-based stats. Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Query 85 SDEEEEFDLDEAPKVVRKKVATENDGVATAEQADSNKAGES 125 +DE + +DEA V KK +NDGV T+ A KAG + Sbjct 258 ADERSKLIMDEA--VQCKKKILQNDGVVTSLCAKPRKAGHT 296 Lambda K H 0.309 0.128 0.352 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2165519004 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40