bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_5078_orf1 Length=74 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_024350 aminopeptidase N, putative (EC:3.4.11.2); K0... 115 4e-26 tpv:TP01_0397 alpha-aminoacylpeptide hydrolase (EC:3.4.11.2); ... 104 6e-23 bbo:BBOV_IV005930 23.m06519; aminopeptidase (EC:3.4.11.2); K01... 102 2e-22 tgo:TGME49_021310 aminopeptidase N, putative (EC:3.4.11.2) 102 3e-22 tgo:TGME49_024460 aminopeptidase N, putative (EC:3.4.11.2) 99.0 3e-21 ath:AT1G63770 peptidase M1 family protein; K01256 aminopeptida... 97.8 8e-21 eco:b0932 pepN, ECK0923, JW0915; aminopeptidase N (EC:3.4.11.2... 95.1 5e-20 cpv:cgd8_3430 zincin/aminopeptidase N like metalloprotease ; K... 88.2 6e-18 pfa:MAL13P1.56 M1-family aminopeptidase (EC:3.4.11.-); K13725 ... 87.8 7e-18 cel:Y67D8C.9 hypothetical protein 39.3 0.003 cel:C42C1.11 hypothetical protein 36.2 0.024 dre:406575 lta4h, zgc:85809; leukotriene A4 hydrolase (EC:3.3.... 35.8 0.036 dre:322533 anpep, fb64c05, wu:fb64c05, zgc:136771; alanyl (mem... 35.8 0.037 cel:ZC416.6 hypothetical protein; K01254 leukotriene-A4 hydrol... 35.4 0.039 cel:F49E8.3 pam-1; Puromycin-sensitive AMinopeptidase family m... 35.4 0.040 hsa:4048 LTA4H; leukotriene A4 hydrolase (EC:3.3.2.6); K01254 ... 34.7 0.076 cel:T07F10.1 hypothetical protein 34.7 0.081 sce:YNL045W LAP2; Lap2p (EC:3.3.2.6); K01254 leukotriene-A4 hy... 34.3 0.086 mmu:16993 Lta4h; leukotriene A4 hydrolase (EC:3.3.2.6); K01254... 34.3 0.086 hsa:4012 LNPEP, CAP, IRAP, P-LAP, PLAP; leucyl/cystinyl aminop... 33.9 0.14 cel:T12E12.6 hypothetical protein 33.1 0.23 xla:432332 lta4h, MGC78867; leukotriene A4 hydrolase (EC:3.3.2... 32.7 0.27 mmu:240028 Lnpep, 2010309L07Rik, 4732490P18Rik, CAP, IRAP, PLA... 32.3 0.37 dre:555478 aminopeptidase N-like; K11140 aminopeptidase N [EC:... 32.3 0.40 xla:495476 anpep; alanyl (membrane) aminopeptidase; K11140 ami... 32.3 0.40 xla:495293 lnpep; leucyl/cystinyl aminopeptidase (EC:3.4.11.3)... 31.6 0.69 cel:R03G8.4 hypothetical protein 31.2 0.74 dre:322814 fb73h12, wu:fb73h12; zgc:66103 (EC:3.4.11.3); K0125... 31.2 0.80 dre:560737 MGC162939, cb974, wu:fa96d09, wu:fc79b08; zgc:16293... 31.2 0.84 hsa:2028 ENPEP, APA, CD249, gp160; glutamyl aminopeptidase (am... 31.2 0.89 mmu:16790 Anpep, Apn, Cd13, Lap-1, Lap1, P150; alanyl (membran... 30.8 1.2 mmu:13809 Enpep, 6030431M22Rik, APA, Bp-1/6C3, Ly-51, Ly51; gl... 30.8 1.2 dre:100004744 aminopeptidase N-like 30.8 1.2 hsa:290 ANPEP, APN, CD13, GP150, LAP1, P150, PEPN; alanyl (mem... 30.4 1.3 xla:379719 hypothetical protein MGC69084 30.4 1.6 xla:443974 MGC80387 protein; K01260 aminopeptidase B [EC:3.4.1... 30.0 1.7 xla:447741 rnpep, MGC82089; arginyl aminopeptidase (aminopepti... 30.0 1.7 mmu:215615 Rnpep, MGC29229; arginyl aminopeptidase (aminopepti... 30.0 1.7 hsa:6051 RNPEP, DKFZp547H084; arginyl aminopeptidase (aminopep... 30.0 1.8 dre:555317 aminopeptidase N-like 30.0 1.8 dre:393175 ARTS-1, MGC56194; zgc:56194; K09604 adipocyte-deriv... 30.0 1.9 dre:564068 endoplasmic reticulum aminopeptidase 1-like; K09604... 29.6 2.3 dre:558452 fd60b03, wu:fd60b03; si:ch211-200o3.4 (EC:3.4.11.2) 29.3 2.8 mmu:80898 Erap1, Arts1, ERAAP, PILSA, PILSAP; endoplasmic reti... 29.3 2.8 hsa:51752 ERAP1, A-LAP, ALAP, APPILS, ARTS-1, ARTS1, ERAAP, ER... 29.3 3.1 hsa:64167 ERAP2, FLJ23633, FLJ23701, FLJ23807, L-RAP, LRAP; en... 29.3 3.2 dre:407726 npepps, Psa, fb68d07, sb:cb848, wu:fb68d07; aminope... 28.9 3.8 mmu:108657 Rnpepl1, 1110014H17Rik, AI894167; arginyl aminopept... 28.9 3.9 hsa:57140 RNPEPL1, FLJ10806, FLJ26675, MGC99544; arginyl amino... 28.9 4.1 mmu:19155 Npepps, AAP-S, MGC102199, MP100, Psa, R74825, goku; ... 28.5 5.1 > tgo:TGME49_024350 aminopeptidase N, putative (EC:3.4.11.2); K01256 aminopeptidase N [EC:3.4.11.2] Length=1419 Score = 115 bits (287), Expect = 4e-26, Method: Compositional matrix adjust. Identities = 51/66 (77%), Positives = 56/66 (84%), Gaps = 0/66 (0%) Query 9 YFHNWTGNRVTVRDWFQLTLKEGLTVFREQLFMGSVLSAGVQRIQEVADLISRQFAEDDG 68 YFHNWTGNRVT RDWFQLTLKEGLTVFR+QLF + SA V+RI++V L SRQFAED G Sbjct 837 YFHNWTGNRVTCRDWFQLTLKEGLTVFRDQLFTADMCSAAVKRIEDVVFLRSRQFAEDSG 896 Query 69 PMAHPI 74 PMAHPI Sbjct 897 PMAHPI 902 > tpv:TP01_0397 alpha-aminoacylpeptide hydrolase (EC:3.4.11.2); K01256 aminopeptidase N [EC:3.4.11.2] Length=1020 Score = 104 bits (260), Expect = 6e-23, Method: Composition-based stats. Identities = 47/66 (71%), Positives = 51/66 (77%), Gaps = 0/66 (0%) Query 9 YFHNWTGNRVTVRDWFQLTLKEGLTVFREQLFMGSVLSAGVQRIQEVADLISRQFAEDDG 68 YFHNWTGNRVT RDWFQLTLKEGLTVFRE F G + S RI+EV L+S QF ED G Sbjct 458 YFHNWTGNRVTCRDWFQLTLKEGLTVFREHQFCGDMSSTLSNRIREVQYLMSVQFPEDSG 517 Query 69 PMAHPI 74 PM+HPI Sbjct 518 PMSHPI 523 > bbo:BBOV_IV005930 23.m06519; aminopeptidase (EC:3.4.11.2); K01256 aminopeptidase N [EC:3.4.11.2] Length=846 Score = 102 bits (255), Expect = 2e-22, Method: Composition-based stats. Identities = 46/66 (69%), Positives = 52/66 (78%), Gaps = 0/66 (0%) Query 9 YFHNWTGNRVTVRDWFQLTLKEGLTVFREQLFMGSVLSAGVQRIQEVADLISRQFAEDDG 68 YFHNWTGNRVT RDWFQLTLKEGLTVFRE F G + S + RI +V +L + QFAED G Sbjct 336 YFHNWTGNRVTCRDWFQLTLKEGLTVFRESEFAGDMSSPLITRITDVRNLRTYQFAEDAG 395 Query 69 PMAHPI 74 P+AHPI Sbjct 396 PLAHPI 401 > tgo:TGME49_021310 aminopeptidase N, putative (EC:3.4.11.2) Length=966 Score = 102 bits (254), Expect = 3e-22, Method: Compositional matrix adjust. Identities = 43/66 (65%), Positives = 56/66 (84%), Gaps = 0/66 (0%) Query 9 YFHNWTGNRVTVRDWFQLTLKEGLTVFREQLFMGSVLSAGVQRIQEVADLISRQFAEDDG 68 YFHNW+GNRVT+RDW +LTLKEGLTV+REQ FMGS S+GV R+++ ++S+QF ED G Sbjct 348 YFHNWSGNRVTLRDWTELTLKEGLTVYREQEFMGSQYSSGVARVEDARLVLSQQFREDSG 407 Query 69 PMAHPI 74 P+AHP+ Sbjct 408 PLAHPV 413 > tgo:TGME49_024460 aminopeptidase N, putative (EC:3.4.11.2) Length=970 Score = 99.0 bits (245), Expect = 3e-21, Method: Compositional matrix adjust. Identities = 44/66 (66%), Positives = 51/66 (77%), Gaps = 0/66 (0%) Query 9 YFHNWTGNRVTVRDWFQLTLKEGLTVFREQLFMGSVLSAGVQRIQEVADLISRQFAEDDG 68 YFHNWTGNRVTV+DWFQLTLKEGLT+FR F S ++RI +VAD++S QF ED G Sbjct 378 YFHNWTGNRVTVQDWFQLTLKEGLTMFRNNSFTEETTSRAMKRIGDVADILSIQFREDSG 437 Query 69 PMAHPI 74 P AHPI Sbjct 438 PFAHPI 443 > ath:AT1G63770 peptidase M1 family protein; K01256 aminopeptidase N [EC:3.4.11.2] Length=987 Score = 97.8 bits (242), Expect = 8e-21, Method: Composition-based stats. Identities = 43/66 (65%), Positives = 51/66 (77%), Gaps = 0/66 (0%) Query 9 YFHNWTGNRVTVRDWFQLTLKEGLTVFREQLFMGSVLSAGVQRIQEVADLISRQFAEDDG 68 YFHNWTGNRVT RDWFQL+LKEGLTVFR+Q F + S V+RI +V+ L QF +D G Sbjct 395 YFHNWTGNRVTCRDWFQLSLKEGLTVFRDQEFSSDMGSRTVKRIADVSKLRIYQFPQDAG 454 Query 69 PMAHPI 74 PMAHP+ Sbjct 455 PMAHPV 460 > eco:b0932 pepN, ECK0923, JW0915; aminopeptidase N (EC:3.4.11.2); K01256 aminopeptidase N [EC:3.4.11.2] Length=870 Score = 95.1 bits (235), Expect = 5e-20, Method: Compositional matrix adjust. Identities = 44/66 (66%), Positives = 48/66 (72%), Gaps = 0/66 (0%) Query 9 YFHNWTGNRVTVRDWFQLTLKEGLTVFREQLFMGSVLSAGVQRIQEVADLISRQFAEDDG 68 YFHNWTGNRVT RDWFQL+LKEGLTVFR+Q F + S V RI V + QFAED Sbjct 299 YFHNWTGNRVTCRDWFQLSLKEGLTVFRDQEFSSDLGSRAVNRINNVRTMRGLQFAEDAS 358 Query 69 PMAHPI 74 PMAHPI Sbjct 359 PMAHPI 364 > cpv:cgd8_3430 zincin/aminopeptidase N like metalloprotease ; K01256 aminopeptidase N [EC:3.4.11.2] Length=936 Score = 88.2 bits (217), Expect = 6e-18, Method: Composition-based stats. Identities = 38/66 (57%), Positives = 49/66 (74%), Gaps = 0/66 (0%) Query 9 YFHNWTGNRVTVRDWFQLTLKEGLTVFREQLFMGSVLSAGVQRIQEVADLISRQFAEDDG 68 YFHN+TGNRVT RDWFQLTLKEGLTV+R+Q F + +++ ++ L + QF ED G Sbjct 338 YFHNYTGNRVTCRDWFQLTLKEGLTVYRDQEFSRDCIDRLSEQLGDIEVLRNYQFQEDSG 397 Query 69 PMAHPI 74 P+AHPI Sbjct 398 PLAHPI 403 > pfa:MAL13P1.56 M1-family aminopeptidase (EC:3.4.11.-); K13725 M1-family aminopeptidase [EC:3.4.11.-] Length=1085 Score = 87.8 bits (216), Expect = 7e-18, Method: Composition-based stats. Identities = 40/66 (60%), Positives = 46/66 (69%), Gaps = 0/66 (0%) Query 9 YFHNWTGNRVTVRDWFQLTLKEGLTVFREQLFMGSVLSAGVQRIQEVADLISRQFAEDDG 68 YFHN+TGNRVT+RDWFQLTLKEGLTV RE LF + R+ V L S QF ED Sbjct 498 YFHNYTGNRVTLRDWFQLTLKEGLTVHRENLFSEEMTKTVTTRLSHVDLLRSVQFLEDSS 557 Query 69 PMAHPI 74 P++HPI Sbjct 558 PLSHPI 563 > cel:Y67D8C.9 hypothetical protein Length=1087 Score = 39.3 bits (90), Expect = 0.003, Method: Composition-based stats. Identities = 22/58 (37%), Positives = 29/58 (50%), Gaps = 2/58 (3%) Query 11 HNWTGNRVTVRDWFQLTLKEGLTVF--REQLFMGSVLSAGVQRIQEVADLISRQFAED 66 H W GN VT+RDW +L L EG F E + ++A + +A LI Q ED Sbjct 442 HQWFGNLVTMRDWSELFLNEGFATFYVYEMMSTERPVTAQFEYYDSLASLILAQSEED 499 > cel:C42C1.11 hypothetical protein Length=609 Score = 36.2 bits (82), Expect = 0.024, Method: Composition-based stats. Identities = 20/58 (34%), Positives = 25/58 (43%), Gaps = 11/58 (18%) Query 11 HNWTGNRVTVRDWFQLTLKEGLTVFREQLFMGSVLSAGVQRIQEVADLISRQFAEDDG 68 H+WTGN VT W L EG TVF E+ G + + RQF + G Sbjct 301 HSWTGNLVTNFSWEHFWLNEGFTVFLERKIHGKMYGE-----------LERQFESESG 347 > dre:406575 lta4h, zgc:85809; leukotriene A4 hydrolase (EC:3.3.2.6); K01254 leukotriene-A4 hydrolase [EC:3.3.2.6] Length=611 Score = 35.8 bits (81), Expect = 0.036, Method: Composition-based stats. Identities = 15/29 (51%), Positives = 19/29 (65%), Gaps = 0/29 (0%) Query 11 HNWTGNRVTVRDWFQLTLKEGLTVFREQL 39 H+WTGN VT R W L EG TV+ E++ Sbjct 299 HSWTGNLVTNRTWEHFWLNEGHTVYIERM 327 > dre:322533 anpep, fb64c05, wu:fb64c05, zgc:136771; alanyl (membrane) aminopeptidase (EC:3.4.11.2); K11140 aminopeptidase N [EC:3.4.11.2] Length=965 Score = 35.8 bits (81), Expect = 0.037, Method: Composition-based stats. Identities = 22/66 (33%), Positives = 35/66 (53%), Gaps = 4/66 (6%) Query 11 HNWTGNRVTVRDWFQLTLKEGLTVFREQLFMGSVLSAGVQRIQEVADL--ISRQFAEDDG 68 H W GN VT+R W L L EG + E ++G+ + + I+++ L + R FA D Sbjct 391 HQWFGNLVTIRWWNDLWLNEGFASYVE--YLGADEAEPLWNIKDLIVLNDVHRVFAIDAL 448 Query 69 PMAHPI 74 +HP+ Sbjct 449 ASSHPL 454 > cel:ZC416.6 hypothetical protein; K01254 leukotriene-A4 hydrolase [EC:3.3.2.6] Length=625 Score = 35.4 bits (80), Expect = 0.039, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 0/36 (0%) Query 11 HNWTGNRVTVRDWFQLTLKEGLTVFREQLFMGSVLS 46 H+W+GN VT W L EG T+F E+ G ++S Sbjct 303 HSWSGNLVTNSSWEHFWLNEGFTMFIERKICGRLVS 338 > cel:F49E8.3 pam-1; Puromycin-sensitive AMinopeptidase family member (pam-1); K08776 puromycin-sensitive aminopeptidase [EC:3.4.11.-] Length=948 Score = 35.4 bits (80), Expect = 0.040, Method: Compositional matrix adjust. Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 0/33 (0%) Query 11 HNWTGNRVTVRDWFQLTLKEGLTVFREQLFMGS 43 H W GN VT++ W L LKEG F E +F+G+ Sbjct 381 HLWFGNLVTMKWWTDLWLKEGFASFMEYMFVGA 413 > hsa:4048 LTA4H; leukotriene A4 hydrolase (EC:3.3.2.6); K01254 leukotriene-A4 hydrolase [EC:3.3.2.6] Length=611 Score = 34.7 bits (78), Expect = 0.076, Method: Composition-based stats. Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 0/35 (0%) Query 11 HNWTGNRVTVRDWFQLTLKEGLTVFREQLFMGSVL 45 H+WTGN VT + W L EG TV+ E+ G + Sbjct 300 HSWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLF 334 > cel:T07F10.1 hypothetical protein Length=988 Score = 34.7 bits (78), Expect = 0.081, Method: Composition-based stats. Identities = 22/66 (33%), Positives = 29/66 (43%), Gaps = 3/66 (4%) Query 11 HNWTGNRVTVRDWFQLTLKEGLTVFREQLFMGSVLSAGVQRIQE--VADLISRQFAEDDG 68 H W GN VT++ W L L EG E L + S G R++E D + A D Sbjct 400 HQWFGNLVTLKWWNDLWLNEGFATLVEYLGTDEI-SDGNMRMREWFTMDALWSALAADSV 458 Query 69 PMAHPI 74 HP+ Sbjct 459 ASTHPL 464 > sce:YNL045W LAP2; Lap2p (EC:3.3.2.6); K01254 leukotriene-A4 hydrolase [EC:3.3.2.6] Length=671 Score = 34.3 bits (77), Expect = 0.086, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 0/34 (0%) Query 11 HNWTGNRVTVRDWFQLTLKEGLTVFREQLFMGSV 44 H+W+GN VT W L EG TV+ E+ +G++ Sbjct 344 HSWSGNLVTNCSWNHFWLNEGWTVYLERRIIGAI 377 > mmu:16993 Lta4h; leukotriene A4 hydrolase (EC:3.3.2.6); K01254 leukotriene-A4 hydrolase [EC:3.3.2.6] Length=611 Score = 34.3 bits (77), Expect = 0.086, Method: Composition-based stats. Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 0/35 (0%) Query 11 HNWTGNRVTVRDWFQLTLKEGLTVFREQLFMGSVL 45 H+WTGN VT + W L EG TV+ E+ G + Sbjct 300 HSWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLF 334 > hsa:4012 LNPEP, CAP, IRAP, P-LAP, PLAP; leucyl/cystinyl aminopeptidase (EC:3.4.11.3); K01257 cystinyl aminopeptidase [EC:3.4.11.3] Length=1025 Score = 33.9 bits (76), Expect = 0.14, Method: Composition-based stats. Identities = 18/64 (28%), Positives = 28/64 (43%), Gaps = 1/64 (1%) Query 11 HNWTGNRVTVRDWFQLTLKEGLTVFREQLFMGSVLSAGVQRIQEVADLISRQFAEDDGPM 70 H W GN VT++ W L L EG F E + + + ++ D + +D Sbjct 468 HQWFGNLVTMKWWNDLWLNEGFATFMEYFSLEKIFKE-LSSYEDFLDARFKTMKKDSLNS 526 Query 71 AHPI 74 +HPI Sbjct 527 SHPI 530 > cel:T12E12.6 hypothetical protein Length=641 Score = 33.1 bits (74), Expect = 0.23, Method: Composition-based stats. Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 3/58 (5%) Query 11 HNWTGNRVTVRDWFQLTLKEGLTVFREQLFMGSVLSAGV--QRIQEVADLISRQFAED 66 H+W GNR T+ W + L+E LT + + ++L+ + QR Q +A + Q ED Sbjct 305 HHWIGNRATIDSWNWICLQEDLTDWMALKAVKALLTDEIRLQRFQ-LAQYVEIQLVED 361 > xla:432332 lta4h, MGC78867; leukotriene A4 hydrolase (EC:3.3.2.6); K01254 leukotriene-A4 hydrolase [EC:3.3.2.6] Length=609 Score = 32.7 bits (73), Expect = 0.27, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 0/34 (0%) Query 11 HNWTGNRVTVRDWFQLTLKEGLTVFREQLFMGSV 44 H+WTGN VT W L EG TV+ E+ G + Sbjct 296 HSWTGNLVTNETWENFWLNEGHTVYLERRIDGRL 329 > mmu:240028 Lnpep, 2010309L07Rik, 4732490P18Rik, CAP, IRAP, PLAP, gp160, vp165; leucyl/cystinyl aminopeptidase (EC:3.4.11.3); K01257 cystinyl aminopeptidase [EC:3.4.11.3] Length=1025 Score = 32.3 bits (72), Expect = 0.37, Method: Composition-based stats. Identities = 18/64 (28%), Positives = 28/64 (43%), Gaps = 1/64 (1%) Query 11 HNWTGNRVTVRDWFQLTLKEGLTVFREQLFMGSVLSAGVQRIQEVADLISRQFAEDDGPM 70 H W GN VT++ W L L EG F E + + + ++ D + +D Sbjct 468 HQWFGNLVTMQWWNDLWLNEGFATFMEYFSVEKIFKE-LNSYEDFLDARFKTMRKDSLNS 526 Query 71 AHPI 74 +HPI Sbjct 527 SHPI 530 > dre:555478 aminopeptidase N-like; K11140 aminopeptidase N [EC:3.4.11.2] Length=960 Score = 32.3 bits (72), Expect = 0.40, Method: Composition-based stats. Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 4/66 (6%) Query 11 HNWTGNRVTVRDWFQLTLKEGLTVFREQLFMGSVLSAGVQRIQEVADL--ISRQFAEDDG 68 H W GN VT++ W L L EG + E ++G+ + I++ L + R FA D Sbjct 384 HMWFGNLVTLKWWNDLWLNEGFASYVE--YLGADHAEPTWNIKDQIILYDMQRAFAVDSL 441 Query 69 PMAHPI 74 +HP+ Sbjct 442 TSSHPL 447 > xla:495476 anpep; alanyl (membrane) aminopeptidase; K11140 aminopeptidase N [EC:3.4.11.2] Length=963 Score = 32.3 bits (72), Expect = 0.40, Method: Composition-based stats. Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 4/66 (6%) Query 11 HNWTGNRVTVRDWFQLTLKEGLTVFREQLFMGSVLSAGVQRIQEVADL--ISRQFAEDDG 68 H W GN VT+R W L L EG + E ++G+ + I+++ L + R A D Sbjct 387 HQWFGNLVTIRWWNDLWLNEGFASYVE--YLGADEAEPDWNIKDLIVLNDVHRVMAVDAL 444 Query 69 PMAHPI 74 +HP+ Sbjct 445 ASSHPL 450 > xla:495293 lnpep; leucyl/cystinyl aminopeptidase (EC:3.4.11.3); K01257 cystinyl aminopeptidase [EC:3.4.11.3] Length=1024 Score = 31.6 bits (70), Expect = 0.69, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 17/35 (48%), Gaps = 0/35 (0%) Query 11 HNWTGNRVTVRDWFQLTLKEGLTVFREQLFMGSVL 45 H W GN VT+ W L L EG + E + SV Sbjct 466 HQWFGNLVTMEWWNDLWLNEGFATYMEYFSVSSVF 500 > cel:R03G8.4 hypothetical protein Length=786 Score = 31.2 bits (69), Expect = 0.74, Method: Composition-based stats. Identities = 12/25 (48%), Positives = 15/25 (60%), Gaps = 0/25 (0%) Query 11 HNWTGNRVTVRDWFQLTLKEGLTVF 35 H W GN VT++ W QL L EG + Sbjct 335 HQWFGNLVTMKFWDQLWLNEGFATY 359 > dre:322814 fb73h12, wu:fb73h12; zgc:66103 (EC:3.4.11.3); K01257 cystinyl aminopeptidase [EC:3.4.11.3] Length=1003 Score = 31.2 bits (69), Expect = 0.80, Method: Composition-based stats. Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 1/64 (1%) Query 11 HNWTGNRVTVRDWFQLTLKEGLTVFREQLFMGSVLSAGVQRIQEVADLISRQFAEDDGPM 70 H W GN VT+R W L L EG + + + + +V I E ++ + A+D Sbjct 448 HQWFGNLVTMRWWNDLWLNEGFATYMQYMSIENVFPDLDIDI-EFLNVRFKALAKDALNS 506 Query 71 AHPI 74 +HP+ Sbjct 507 SHPV 510 > dre:560737 MGC162939, cb974, wu:fa96d09, wu:fc79b08; zgc:162939; K09606 aminopeptidase O [EC:3.4.11.-] Length=787 Score = 31.2 bits (69), Expect = 0.84, Method: Compositional matrix adjust. Identities = 13/44 (29%), Positives = 21/44 (47%), Gaps = 0/44 (0%) Query 11 HNWTGNRVTVRDWFQLTLKEGLTVFREQLFMGSVLSAGVQRIQE 54 H+W G + RDW + + EG + E +F V G + +E Sbjct 448 HSWFGLAIGARDWTEEWISEGFATYLEDVFWSHVQKLGCREAEE 491 > hsa:2028 ENPEP, APA, CD249, gp160; glutamyl aminopeptidase (aminopeptidase A) (EC:3.4.11.7); K11141 glutamyl aminopeptidase [EC:3.4.11.7] Length=957 Score = 31.2 bits (69), Expect = 0.89, Method: Composition-based stats. Identities = 25/66 (37%), Positives = 32/66 (48%), Gaps = 4/66 (6%) Query 11 HNWTGNRVTVRDWFQLTLKEGLTVFREQLFMGSVLSAGVQRIQE-VADLISRQFAEDDGP 69 H W GN VT+ W L L EG F E L + + R Q + D++ Q EDD Sbjct 397 HQWFGNIVTMDWWEDLWLNEGFASFFEFLGVNHAETDWQMRDQMLLEDVLPVQ--EDDSL 454 Query 70 M-AHPI 74 M +HPI Sbjct 455 MSSHPI 460 > mmu:16790 Anpep, Apn, Cd13, Lap-1, Lap1, P150; alanyl (membrane) aminopeptidase (EC:3.4.11.2); K11140 aminopeptidase N [EC:3.4.11.2] Length=966 Score = 30.8 bits (68), Expect = 1.2, Method: Composition-based stats. Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 4/66 (6%) Query 11 HNWTGNRVTVRDWFQLTLKEGLTVFREQLFMGSVLSAGVQRIQEVADL--ISRQFAEDDG 68 H W GN VTV W L L EG + E ++G+ + ++++ L + R A D Sbjct 391 HQWFGNLVTVAWWNDLWLNEGFASYVE--YLGADYAEPTWNLKDLMVLNDVYRVMAVDAL 448 Query 69 PMAHPI 74 +HP+ Sbjct 449 ASSHPL 454 > mmu:13809 Enpep, 6030431M22Rik, APA, Bp-1/6C3, Ly-51, Ly51; glutamyl aminopeptidase (EC:3.4.11.7); K11141 glutamyl aminopeptidase [EC:3.4.11.7] Length=945 Score = 30.8 bits (68), Expect = 1.2, Method: Composition-based stats. Identities = 22/72 (30%), Positives = 31/72 (43%), Gaps = 16/72 (22%) Query 11 HNWTGNRVTVRDWFQLTLKEGLTVFREQLFMGSVLSAGVQRIQEVADLISRQFAEDDGPM 70 H W GN VT+ W L L EG F E L GV ++ ++S+ ED P+ Sbjct 389 HQWFGNTVTMDWWDDLWLNEGFASFFEFL--------GVNHAEKDWQMLSQVLLEDVFPV 440 Query 71 --------AHPI 74 +HP+ Sbjct 441 QEDDSLMSSHPV 452 > dre:100004744 aminopeptidase N-like Length=936 Score = 30.8 bits (68), Expect = 1.2, Method: Composition-based stats. Identities = 18/66 (27%), Positives = 34/66 (51%), Gaps = 4/66 (6%) Query 11 HNWTGNRVTVRDWFQLTLKEGLTVFREQLFMGSVLSAGVQRIQEVADL--ISRQFAEDDG 68 H W GN VT++ W ++ L EG + ++G+ + ++++ L + R FA D Sbjct 363 HMWFGNLVTLKWWNEVWLNEGFASYVS--YLGADFAEPSWNVKDLIILKDVHRVFAVDAL 420 Query 69 PMAHPI 74 +HP+ Sbjct 421 ASSHPL 426 > hsa:290 ANPEP, APN, CD13, GP150, LAP1, P150, PEPN; alanyl (membrane) aminopeptidase (EC:3.4.11.2); K11140 aminopeptidase N [EC:3.4.11.2] Length=967 Score = 30.4 bits (67), Expect = 1.3, Method: Composition-based stats. Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 4/66 (6%) Query 11 HNWTGNRVTVRDWFQLTLKEGLTVFREQLFMGSVLSAGVQRIQEVADL--ISRQFAEDDG 68 H W GN VT+ W L L EG + E ++G+ + ++++ L + R A D Sbjct 392 HQWFGNLVTIEWWNDLWLNEGFASYVE--YLGADYAEPTWNLKDLMVLNDVYRVMAVDAL 449 Query 69 PMAHPI 74 +HP+ Sbjct 450 ASSHPL 455 > xla:379719 hypothetical protein MGC69084 Length=997 Score = 30.4 bits (67), Expect = 1.6, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 0/35 (0%) Query 11 HNWTGNRVTVRDWFQLTLKEGLTVFREQLFMGSVL 45 H W GN VT+ W L L EG + E + S+ Sbjct 464 HQWFGNLVTMEWWNDLWLNEGFATYMEYFSVSSLF 498 > xla:443974 MGC80387 protein; K01260 aminopeptidase B [EC:3.4.11.6] Length=618 Score = 30.0 bits (66), Expect = 1.7, Method: Composition-based stats. Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 0/28 (0%) Query 11 HNWTGNRVTVRDWFQLTLKEGLTVFREQ 38 H+W GN VT +W + L EG T++ ++ Sbjct 300 HSWFGNLVTNANWGEFWLNEGFTMYAQR 327 > xla:447741 rnpep, MGC82089; arginyl aminopeptidase (aminopeptidase B); K01260 aminopeptidase B [EC:3.4.11.6] Length=612 Score = 30.0 bits (66), Expect = 1.7, Method: Composition-based stats. Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 0/28 (0%) Query 11 HNWTGNRVTVRDWFQLTLKEGLTVFREQ 38 H+W GN VT +W + L EG T++ ++ Sbjct 294 HSWFGNLVTNANWGEFWLNEGFTMYAQR 321 > mmu:215615 Rnpep, MGC29229; arginyl aminopeptidase (aminopeptidase B) (EC:3.4.11.6); K01260 aminopeptidase B [EC:3.4.11.6] Length=611 Score = 30.0 bits (66), Expect = 1.7, Method: Composition-based stats. Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 0/28 (0%) Query 11 HNWTGNRVTVRDWFQLTLKEGLTVFREQ 38 H+W GN VT +W + L EG T++ ++ Sbjct 290 HSWFGNLVTNANWGEFWLNEGFTMYAQR 317 > hsa:6051 RNPEP, DKFZp547H084; arginyl aminopeptidase (aminopeptidase B) (EC:3.4.11.6); K01260 aminopeptidase B [EC:3.4.11.6] Length=650 Score = 30.0 bits (66), Expect = 1.8, Method: Composition-based stats. Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 0/28 (0%) Query 11 HNWTGNRVTVRDWFQLTLKEGLTVFREQ 38 H+W GN VT +W + L EG T++ ++ Sbjct 329 HSWFGNLVTNANWGEFWLNEGFTMYAQR 356 > dre:555317 aminopeptidase N-like Length=956 Score = 30.0 bits (66), Expect = 1.8, Method: Composition-based stats. Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 4/66 (6%) Query 11 HNWTGNRVTVRDWFQLTLKEGLTVFREQLFMGSVLSAGVQRIQEVADL--ISRQFAEDDG 68 H W GN VT+R W L L EG + ++ + + I+E+ L + R F D Sbjct 388 HMWFGNLVTMRWWNDLWLNEGFASYVS--YLAADYAEPTWNIKELMVLQQVYRAFTVDAL 445 Query 69 PMAHPI 74 +HP+ Sbjct 446 VSSHPL 451 > dre:393175 ARTS-1, MGC56194; zgc:56194; K09604 adipocyte-derived leucine aminopeptidase [EC:3.4.11.-] Length=963 Score = 30.0 bits (66), Expect = 1.9, Method: Composition-based stats. Identities = 13/27 (48%), Positives = 15/27 (55%), Gaps = 0/27 (0%) Query 11 HNWTGNRVTVRDWFQLTLKEGLTVFRE 37 H W GN VT++ W L L EG F E Sbjct 369 HQWFGNLVTMQWWNDLWLNEGFAKFME 395 > dre:564068 endoplasmic reticulum aminopeptidase 1-like; K09604 adipocyte-derived leucine aminopeptidase [EC:3.4.11.-] Length=908 Score = 29.6 bits (65), Expect = 2.3, Method: Composition-based stats. Identities = 13/27 (48%), Positives = 15/27 (55%), Gaps = 0/27 (0%) Query 11 HNWTGNRVTVRDWFQLTLKEGLTVFRE 37 H W GN VT++ W L L EG F E Sbjct 321 HQWFGNLVTMQWWNDLWLNEGFAKFME 347 > dre:558452 fd60b03, wu:fd60b03; si:ch211-200o3.4 (EC:3.4.11.2) Length=946 Score = 29.3 bits (64), Expect = 2.8, Method: Composition-based stats. Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 0/25 (0%) Query 11 HNWTGNRVTVRDWFQLTLKEGLTVF 35 H W GN VT+ W L LKEG + Sbjct 386 HQWFGNLVTMSWWNDLWLKEGFATY 410 > mmu:80898 Erap1, Arts1, ERAAP, PILSA, PILSAP; endoplasmic reticulum aminopeptidase 1; K09604 adipocyte-derived leucine aminopeptidase [EC:3.4.11.-] Length=930 Score = 29.3 bits (64), Expect = 2.8, Method: Composition-based stats. Identities = 13/27 (48%), Positives = 14/27 (51%), Gaps = 0/27 (0%) Query 11 HNWTGNRVTVRDWFQLTLKEGLTVFRE 37 H W GN VT+ W L L EG F E Sbjct 346 HQWFGNLVTMEWWNDLWLNEGFAKFME 372 > hsa:51752 ERAP1, A-LAP, ALAP, APPILS, ARTS-1, ARTS1, ERAAP, ERAAP1, KIAA0525, PILS-AP, PILSAP; endoplasmic reticulum aminopeptidase 1; K09604 adipocyte-derived leucine aminopeptidase [EC:3.4.11.-] Length=941 Score = 29.3 bits (64), Expect = 3.1, Method: Composition-based stats. Identities = 13/27 (48%), Positives = 14/27 (51%), Gaps = 0/27 (0%) Query 11 HNWTGNRVTVRDWFQLTLKEGLTVFRE 37 H W GN VT+ W L L EG F E Sbjct 357 HQWFGNLVTMEWWNDLWLNEGFAKFME 383 > hsa:64167 ERAP2, FLJ23633, FLJ23701, FLJ23807, L-RAP, LRAP; endoplasmic reticulum aminopeptidase 2 (EC:3.4.11.-); K13723 endoplasmic reticulum aminopeptidase 2 [EC:3.4.11.-] Length=960 Score = 29.3 bits (64), Expect = 3.2, Method: Composition-based stats. Identities = 12/27 (44%), Positives = 15/27 (55%), Gaps = 0/27 (0%) Query 11 HNWTGNRVTVRDWFQLTLKEGLTVFRE 37 H W GN VT+ W + LKEG + E Sbjct 374 HQWFGNLVTMEWWNDIWLKEGFAKYME 400 > dre:407726 npepps, Psa, fb68d07, sb:cb848, wu:fb68d07; aminopeptidase puromycin sensitive (EC:3.4.11.-); K08776 puromycin-sensitive aminopeptidase [EC:3.4.11.-] Length=872 Score = 28.9 bits (63), Expect = 3.8, Method: Compositional matrix adjust. Identities = 20/64 (31%), Positives = 26/64 (40%), Gaps = 0/64 (0%) Query 11 HNWTGNRVTVRDWFQLTLKEGLTVFREQLFMGSVLSAGVQRIQEVADLISRQFAEDDGPM 70 H W GN VT+ W L L EG + E L + Q V+ +R D Sbjct 311 HQWFGNLVTMEWWTHLWLNEGFASWIEYLCVDHCFPEYDIWTQFVSADYTRALDLDALDN 370 Query 71 AHPI 74 +HPI Sbjct 371 SHPI 374 > mmu:108657 Rnpepl1, 1110014H17Rik, AI894167; arginyl aminopeptidase (aminopeptidase B)-like 1; K09605 arginyl aminopeptidase-like 1 [EC:3.4.11.-] Length=720 Score = 28.9 bits (63), Expect = 3.9, Method: Compositional matrix adjust. Identities = 11/28 (39%), Positives = 17/28 (60%), Gaps = 0/28 (0%) Query 11 HNWTGNRVTVRDWFQLTLKEGLTVFREQ 38 H+W GN VT W ++ L EGL + ++ Sbjct 352 HSWFGNAVTNATWEEMWLSEGLATYAQR 379 > hsa:57140 RNPEPL1, FLJ10806, FLJ26675, MGC99544; arginyl aminopeptidase (aminopeptidase B)-like 1; K09605 arginyl aminopeptidase-like 1 [EC:3.4.11.-] Length=725 Score = 28.9 bits (63), Expect = 4.1, Method: Compositional matrix adjust. Identities = 11/28 (39%), Positives = 17/28 (60%), Gaps = 0/28 (0%) Query 11 HNWTGNRVTVRDWFQLTLKEGLTVFREQ 38 H+W GN VT W ++ L EGL + ++ Sbjct 357 HSWFGNAVTNATWEEMWLSEGLATYAQR 384 > mmu:19155 Npepps, AAP-S, MGC102199, MP100, Psa, R74825, goku; aminopeptidase puromycin sensitive (EC:3.4.11.14); K08776 puromycin-sensitive aminopeptidase [EC:3.4.11.-] Length=920 Score = 28.5 bits (62), Expect = 5.1, Method: Composition-based stats. Identities = 13/29 (44%), Positives = 15/29 (51%), Gaps = 0/29 (0%) Query 11 HNWTGNRVTVRDWFQLTLKEGLTVFREQL 39 H W GN VT+ W L L EG + E L Sbjct 357 HQWFGNLVTMEWWTHLWLNEGFASWIEYL 385 Lambda K H 0.323 0.137 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2007182052 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40