bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_5098_orf1 Length=64 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_040890 phosphofructokinase, putative (EC:2.7.1.90);... 80.5 1e-15 pfa:PFI0755c 6-phosphofructokinase, putative; K00850 6-phospho... 48.9 4e-06 bbo:BBOV_II006170 18.m06510; 6-phosphofructokinase (EC:2.7.1.9... 42.0 4e-04 cpv:cgd2_2130 pyrophosphate-dependent phosphofructokinase (EC:... 40.8 0.001 tpv:TP02_0577 6-phosphofructokinase 35.4 0.046 mmu:69228 Zfp746, 2810407L07Rik, AI317225, Znf746; zinc finger... 30.4 1.3 hsa:155061 ZNF746, FLJ31413; zinc finger protein 746; K09228 K... 30.4 1.3 tpv:TP04_0683 heat shock protein 70; K09490 heat shock 70kDa p... 27.7 9.5 > tgo:TGME49_040890 phosphofructokinase, putative (EC:2.7.1.90); K00850 6-phosphofructokinase [EC:2.7.1.11] Length=1399 Score = 80.5 bits (197), Expect = 1e-15, Method: Composition-based stats. Identities = 38/56 (67%), Positives = 44/56 (78%), Gaps = 0/56 (0%) Query 9 DALLMHLPNMKILLAELRRIIREAQSKGEMKKAQQQLMDVDSWAANEPDSWNWRLT 64 DALLMHLPNMKILLAELR +++EA +KGEMKKAQQ L DV + P+SW RLT Sbjct 1026 DALLMHLPNMKILLAELRSVLKEADAKGEMKKAQQDLNDVTDTDSCPPESWGRRLT 1081 > pfa:PFI0755c 6-phosphofructokinase, putative; K00850 6-phosphofructokinase [EC:2.7.1.11] Length=1418 Score = 48.9 bits (115), Expect = 4e-06, Method: Composition-based stats. Identities = 21/40 (52%), Positives = 32/40 (80%), Gaps = 0/40 (0%) Query 9 DALLMHLPNMKILLAELRRIIREAQSKGEMKKAQQQLMDV 48 DALLMHLP+MKILL+E+ I+ EA KG++ +A+ L+++ Sbjct 1088 DALLMHLPHMKILLSEISDILNEASEKGQLLEARNDLVNL 1127 > bbo:BBOV_II006170 18.m06510; 6-phosphofructokinase (EC:2.7.1.90); K00850 6-phosphofructokinase [EC:2.7.1.11] Length=1337 Score = 42.0 bits (97), Expect = 4e-04, Method: Composition-based stats. Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 3/53 (5%) Query 9 DALLMHLPNMKILLAELRRIIREAQSKGEMKKAQQQLMDVDSWAANEPDSWNW 61 D L++HLPN K +L ELR ++ EA + + ++A ++ D +EP S W Sbjct 1008 DHLILHLPNTKSMLMELRSVLMEASAANKRREAVDSFLNYDK---SEPQSSEW 1057 > cpv:cgd2_2130 pyrophosphate-dependent phosphofructokinase (EC:2.7.1.11); K00850 6-phosphofructokinase [EC:2.7.1.11] Length=1426 Score = 40.8 bits (94), Expect = 0.001, Method: Composition-based stats. Identities = 18/40 (45%), Positives = 27/40 (67%), Gaps = 0/40 (0%) Query 9 DALLMHLPNMKILLAELRRIIREAQSKGEMKKAQQQLMDV 48 DALL HLP+MKIL++E+ + R A+ EMK ++M + Sbjct 1014 DALLSHLPDMKILISEINELRRFAEEHSEMKLFMSEMMSL 1053 > tpv:TP02_0577 6-phosphofructokinase Length=1692 Score = 35.4 bits (80), Expect = 0.046, Method: Composition-based stats. Identities = 16/44 (36%), Positives = 27/44 (61%), Gaps = 0/44 (0%) Query 9 DALLMHLPNMKILLAELRRIIREAQSKGEMKKAQQQLMDVDSWA 52 D L++HLP+ K +L E+ + +A K + K A QQLM + ++ Sbjct 1319 DHLVLHLPSTKNMLQEIGTALTKANQKNQRKHAIQQLMSYNVYS 1362 > mmu:69228 Zfp746, 2810407L07Rik, AI317225, Znf746; zinc finger protein 746; K09228 KRAB domain-containing zinc finger protein Length=652 Score = 30.4 bits (67), Expect = 1.3, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 22/30 (73%), Gaps = 0/30 (0%) Query 28 IIREAQSKGEMKKAQQQLMDVDSWAANEPD 57 ++ + + +GE++ +QQ + V++WAA +PD Sbjct 184 LLMQIKQEGELQLQEQQALGVEAWAAGQPD 213 > hsa:155061 ZNF746, FLJ31413; zinc finger protein 746; K09228 KRAB domain-containing zinc finger protein Length=645 Score = 30.4 bits (67), Expect = 1.3, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 22/30 (73%), Gaps = 0/30 (0%) Query 28 IIREAQSKGEMKKAQQQLMDVDSWAANEPD 57 ++ + + +GE++ +QQ + V++WAA +PD Sbjct 184 LLMQIKQEGELQLQEQQALGVEAWAAGQPD 213 > tpv:TP04_0683 heat shock protein 70; K09490 heat shock 70kDa protein 5 Length=655 Score = 27.7 bits (60), Expect = 9.5, Method: Composition-based stats. Identities = 13/51 (25%), Positives = 27/51 (52%), Gaps = 5/51 (9%) Query 12 LMHLPNMKILLAELRRIIREAQ-----SKGEMKKAQQQLMDVDSWAANEPD 57 +M +++ + +RR ++E SK E+ K +++L D +W + PD Sbjct 562 IMSKQSLENYIDSMRRTLKEDSVSSKLSKSEVSKLKEELDDASNWMGSHPD 612 Lambda K H 0.317 0.126 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2051595972 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40