bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_5271_orf3 Length=109 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_014590 microfibrillar-associated protein 1, putativ... 63.5 2e-10 tpv:TP04_0360 hypothetical protein; K13110 microfibrillar-asso... 42.0 5e-04 ath:AT5G17900 hypothetical protein; K13110 microfibrillar-asso... 37.7 0.010 ath:AT4G08580 hypothetical protein 37.0 0.017 dre:393992 mfap1, MGC56551, zgc:56551; microfibrillar-associat... 36.6 0.019 bbo:BBOV_II002390 18.m06195; micro-fibrillar-associated protei... 33.1 0.25 xla:735061 hypothetical protein MGC85054; K13110 microfibrilla... 31.6 0.71 hsa:4236 MFAP1; microfibrillar-associated protein 1; K13110 mi... 30.8 1.1 xla:379834 mfap1, MGC53463; microfibrillar-associated protein 1 30.4 cel:F43G9.10 hypothetical protein; K13110 microfibrillar-assoc... 30.4 1.6 mmu:67532 Mfap1a, 4432409M24Rik, Mfap1; microfibrillar-associa... 28.5 5.2 mmu:100034361 Mfap1b; microfibrillar-associated protein 1B; K1... 28.5 5.2 > tgo:TGME49_014590 microfibrillar-associated protein 1, putative ; K13110 microfibrillar-associated protein 1 Length=438 Score = 63.5 bits (153), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 39/94 (41%), Positives = 53/94 (56%), Gaps = 26/94 (27%) Query 22 RKLETKQMVYAVLAREDEEAADAPVIPVEAQQQQQQQQQQQKNLMGSE------EMPDDT 75 RK E+K+++Y L +EDEE + N++G + E+PDDT Sbjct 222 RKRESKKLLYEALQKEDEE--------------------MRTNMLGEQLQEEDCELPDDT 261 Query 76 DGLDAAQEYEDWKLRELERIRRDKEEQLEREKFL 109 DGLDA EYE WK REL RI+RD+EE+ R+ FL Sbjct 262 DGLDAEAEYEAWKARELLRIKRDQEERQARDNFL 295 > tpv:TP04_0360 hypothetical protein; K13110 microfibrillar-associated protein 1 Length=408 Score = 42.0 bits (97), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 24/36 (66%), Positives = 27/36 (75%), Gaps = 4/36 (11%) Query 73 DDTDGLDAAQEYEDWKLRELERIRRDKEEQLEREKF 108 DDTD D +EYE WK+REL+RI RDKE EREKF Sbjct 244 DDTDTFDE-KEYELWKIRELKRILRDKE---EREKF 275 > ath:AT5G17900 hypothetical protein; K13110 microfibrillar-associated protein 1 Length=435 Score = 37.7 bits (86), Expect = 0.010, Method: Compositional matrix adjust. Identities = 35/97 (36%), Positives = 51/97 (52%), Gaps = 26/97 (26%) Query 16 QQQVEQRKLETKQMVYAVLAREDEEAADAPVIPVEAQQQQQQQQQQQKNLMGSEEMPDDT 75 ++++EQRKLETKQ+V + R+DEE +KN++ E D Sbjct 212 KRKLEQRKLETKQIVVEEV-RKDEEI--------------------RKNILLEEANIGDV 250 Query 76 ---DGLDAAQEYEDWKLRELERIR--RDKEEQLEREK 107 D L+ A+EYE WK RE+ RI+ RD E + RE+ Sbjct 251 ETDDELNEAEEYEVWKTREIGRIKRERDAREAMLRER 287 > ath:AT4G08580 hypothetical protein Length=435 Score = 37.0 bits (84), Expect = 0.017, Method: Compositional matrix adjust. Identities = 34/97 (35%), Positives = 51/97 (52%), Gaps = 26/97 (26%) Query 16 QQQVEQRKLETKQMVYAVLAREDEEAADAPVIPVEAQQQQQQQQQQQKNLMGSEEMPDDT 75 ++++EQRK+ETKQ+V + R+DEE +KN++ E D Sbjct 212 KRKLEQRKIETKQIVVEEV-RKDEEI--------------------RKNILLEEANIGDV 250 Query 76 ---DGLDAAQEYEDWKLRELERIR--RDKEEQLEREK 107 D L+ A+EYE WK RE+ RI+ RD E + RE+ Sbjct 251 ETDDELNEAEEYEVWKTREIGRIKRERDAREAMLRER 287 > dre:393992 mfap1, MGC56551, zgc:56551; microfibrillar-associated protein 1; K13110 microfibrillar-associated protein 1 Length=437 Score = 36.6 bits (83), Expect = 0.019, Method: Compositional matrix adjust. Identities = 22/36 (61%), Positives = 29/36 (80%), Gaps = 2/36 (5%) Query 74 DTDGLDAAQEYEDWKLRELERIRRDKE--EQLEREK 107 DTDG + +EYE WK+REL+RI+RD+E E LE+EK Sbjct 265 DTDGENEEEEYEAWKVRELKRIKRDRESREALEKEK 300 > bbo:BBOV_II002390 18.m06195; micro-fibrillar-associated protein 1 C-terminus containing protein; K13110 microfibrillar-associated protein 1 Length=437 Score = 33.1 bits (74), Expect = 0.25, Method: Compositional matrix adjust. Identities = 18/36 (50%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Query 73 DDTDGLDAAQEYEDWKLRELERIRRDKEEQLEREKF 108 DD D L +EYE WK+REL+RI RD+ E+ E+ Sbjct 264 DDKDEL-TEEEYELWKIRELKRIIRDRNERNAHERL 298 > xla:735061 hypothetical protein MGC85054; K13110 microfibrillar-associated protein 1 Length=442 Score = 31.6 bits (70), Expect = 0.71, Method: Compositional matrix adjust. Identities = 15/23 (65%), Positives = 21/23 (91%), Gaps = 2/23 (8%) Query 87 WKLRELERIRRDKEEQ--LEREK 107 WK+REL+RI+RD+EE+ LE+EK Sbjct 282 WKVRELKRIKRDREEREALEKEK 304 > hsa:4236 MFAP1; microfibrillar-associated protein 1; K13110 microfibrillar-associated protein 1 Length=439 Score = 30.8 bits (68), Expect = 1.1, Method: Compositional matrix adjust. Identities = 15/23 (65%), Positives = 20/23 (86%), Gaps = 2/23 (8%) Query 87 WKLRELERIRRDKE--EQLEREK 107 WK+REL+RI+RD+E E LE+EK Sbjct 279 WKVRELKRIKRDREDREALEKEK 301 > xla:379834 mfap1, MGC53463; microfibrillar-associated protein 1 Length=441 Score = 30.4 bits (67), Expect = 1.4, Method: Compositional matrix adjust. Identities = 14/23 (60%), Positives = 21/23 (91%), Gaps = 2/23 (8%) Query 87 WKLRELERIRRDKEEQ--LEREK 107 WK+REL+RI+RD+EE+ +E+EK Sbjct 281 WKVRELKRIKRDREEREAMEKEK 303 > cel:F43G9.10 hypothetical protein; K13110 microfibrillar-associated protein 1 Length=466 Score = 30.4 bits (67), Expect = 1.6, Method: Compositional matrix adjust. Identities = 24/87 (27%), Positives = 51/87 (58%), Gaps = 19/87 (21%) Query 16 QQQVEQRKLETKQMVYAVLAREDEEAADAPVIPVEAQQQQQQQQQQQKNLMGSEEMPDDT 75 +++ E+RK E+ ++V VL ++EEAA ++++ + + + S D+T Sbjct 255 EKRAEERKRESAKLVEKVL--QEEEAA-------------EKRKTEDRVDLSSVLTDDET 299 Query 76 DGLDAAQEYEDWKLRELERIRRDKEEQ 102 + + YE WKLRE++R++R+++E+ Sbjct 300 ENM----AYEAWKLREMKRLKRNRDER 322 > mmu:67532 Mfap1a, 4432409M24Rik, Mfap1; microfibrillar-associated protein 1A Length=439 Score = 28.5 bits (62), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/23 (60%), Positives = 20/23 (86%), Gaps = 2/23 (8%) Query 87 WKLRELERIRRDKE--EQLEREK 107 WK+REL+RI+R++E E LE+EK Sbjct 279 WKVRELKRIKREREDREALEKEK 301 > mmu:100034361 Mfap1b; microfibrillar-associated protein 1B; K13110 microfibrillar-associated protein 1 Length=439 Score = 28.5 bits (62), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/23 (60%), Positives = 20/23 (86%), Gaps = 2/23 (8%) Query 87 WKLRELERIRRDKE--EQLEREK 107 WK+REL+RI+R++E E LE+EK Sbjct 279 WKVRELKRIKREREDREALEKEK 301 Lambda K H 0.307 0.122 0.317 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2072286120 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40