bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_6337_orf1 Length=110 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_057010 insulysin, putative (EC:3.4.24.56); K01408 i... 101 8e-22 pfa:PF10_0394 rifin; K13851 repetitive interspersed family pro... 31.6 0.58 hsa:56169 GSDMC, MLZE; gasdermin C 30.8 1.1 cel:T11G6.5 hypothetical protein 30.4 1.4 ath:AT1G60920 agl55; agl55 (AGAMOUS-LIKE 55); DNA binding / tr... 30.0 1.9 dre:414272 rgma, MGC110534, MGC192952, dlm, hfe2, id:ibd2030, ... 28.5 5.1 cel:W02D9.1 pri-2; DNA PRImase homolog family member (pri-2); ... 28.5 5.3 hsa:3096 HIVEP1, CIRIP, CRYBP1, MBP-1, PRDII-BF1, Schnurri-1, ... 28.1 6.9 sce:YLR389C STE23; Metalloprotease involved, with homolog Axl1... 28.1 7.2 dre:336319 fj63c11; wu:fj63c11 27.7 9.0 xla:100125672 c17orf28; chromosome 17 open reading frame 28 27.7 ath:AT2G05070 LHCB2.2; chlorophyll binding; K08913 light-harve... 27.7 9.9 > tgo:TGME49_057010 insulysin, putative (EC:3.4.24.56); K01408 insulysin [EC:3.4.24.56] Length=953 Score = 101 bits (251), Expect = 8e-22, Method: Compositional matrix adjust. Identities = 40/109 (36%), Positives = 69/109 (63%), Gaps = 0/109 (0%) Query 1 ADPEFSSKVESFETDPYYGVQFRVLDLPQHHAVAMTVLTASPNAFRMPPPLLHIPKASEL 60 ADP+F +SF+ +P+YG+++++ +LP+ + +T SP A+++PP L H+P+ +L Sbjct 457 ADPQFKRNNDSFDVEPFYGIEYKITNLPKEQRRRLETVTPSPGAYKIPPALKHVPRPEDL 516 Query 61 EILPGLLGLNEPELISEQGGNAGTAVWWQGQGFSALPRVAVQLSGSIAK 109 +LP L G++ PEL+ + + G AVWWQGQG +PRV + + Sbjct 517 HLLPALGGMSIPELLGDSNTSGGHAVWWQGQGTLPVPRVHANIKARTQR 565 > pfa:PF10_0394 rifin; K13851 repetitive interspersed family protein Length=309 Score = 31.6 bits (70), Expect = 0.58, Method: Compositional matrix adjust. Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Query 41 SPNAFRMPPPLLHIPKASELEILPGLLGLNEPELISEQGGNAGTAVWW 88 + +R P L A++ E+ G +G E EL+ Q G GT +W+ Sbjct 186 NKETYRCPQALTTSIYAAKQEVCVGKIG--ETELVCNQLGQGGTPIWF 231 > hsa:56169 GSDMC, MLZE; gasdermin C Length=508 Score = 30.8 bits (68), Expect = 1.1, Method: Compositional matrix adjust. Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 8/46 (17%) Query 27 LPQHHAVAMTVLTASPNAFRMPPPLL--------HIPKASELEILP 64 LP H ++ T+ AS N ++ P L H+PK ++ ILP Sbjct 259 LPSFHTISPTLFNASSNDMKLKPELFLTQQFLSGHLPKYEQVHILP 304 > cel:T11G6.5 hypothetical protein Length=1406 Score = 30.4 bits (67), Expect = 1.4, Method: Composition-based stats. Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 0/29 (0%) Query 30 HHAVAMTVLTASPNAFRMPPPLLHIPKAS 58 H A T + SP F PPP+LH P+++ Sbjct 614 HSASISTNIPGSPTQFNRPPPVLHSPRSA 642 > ath:AT1G60920 agl55; agl55 (AGAMOUS-LIKE 55); DNA binding / transcription factor Length=191 Score = 30.0 bits (66), Expect = 1.9, Method: Compositional matrix adjust. Identities = 12/38 (31%), Positives = 17/38 (44%), Gaps = 0/38 (0%) Query 62 ILPGLLGLNEPELISEQGGNAGTAVWWQGQGFSALPRV 99 ++ LL P L + Q +G WW+ Q F L V Sbjct 72 VVSSLLHNQHPSLPTNQDNRSGLGFWWEDQAFDRLENV 109 > dre:414272 rgma, MGC110534, MGC192952, dlm, hfe2, id:ibd2030, rgmc, wu:fb72h09, zgc:110534; RGM domain family, member A; K06847 RGM domain family Length=449 Score = 28.5 bits (62), Expect = 5.1, Method: Composition-based stats. Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 0/40 (0%) Query 17 YYGVQFRVLDLPQHHAVAMTVLTASPNAFRMPPPLLHIPK 56 Y+ Q + DL H + T P A +PPP+L P+ Sbjct 94 YHSAQHGIEDLMSQHNCSKEGPTTQPRARTVPPPVLSPPQ 133 > cel:W02D9.1 pri-2; DNA PRImase homolog family member (pri-2); K02685 DNA primase large subunit [EC:2.7.7.-] Length=503 Score = 28.5 bits (62), Expect = 5.3, Method: Composition-based stats. Identities = 21/73 (28%), Positives = 31/73 (42%), Gaps = 12/73 (16%) Query 4 EFSSKVESFETDPYYGVQFRVLDLPQHHAVAMTVLTASPNAFRMPP--------PLLHIP 55 EF+ K+ S + D YG R + + VA T ++ + R PP P H Sbjct 352 EFTKKITSDKFDKEYGYNIRYMYGKEGRRVAQTAMSCATIILRNPPSAVDCHGCPFRH-- 409 Query 56 KASELEILPGLLG 68 SE ++L LG Sbjct 410 --SEKQVLKQKLG 420 > hsa:3096 HIVEP1, CIRIP, CRYBP1, MBP-1, PRDII-BF1, Schnurri-1, ZAS1, ZNF40, ZNF40A; human immunodeficiency virus type I enhancer binding protein 1; K09239 human immunodeficiency virus type I enhancer-binding protein Length=2718 Score = 28.1 bits (61), Expect = 6.9, Method: Compositional matrix adjust. Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Query 31 HAVAMTVLTASPNAFRMPPPLLHIPKASELEI-LPGLL 67 +AV + VLTA+P++ P P HIP L I LP L+ Sbjct 2518 NAVGLQVLTANPSSQSSPAPQAHIPGLQILNIALPTLI 2555 > sce:YLR389C STE23; Metalloprotease involved, with homolog Axl1p, in N-terminal processing of pro-A-factor to the mature form; member of the insulin-degrading enzyme family (EC:3.4.24.-); K01408 insulysin [EC:3.4.24.56] Length=1027 Score = 28.1 bits (61), Expect = 7.2, Method: Composition-based stats. Identities = 17/70 (24%), Positives = 34/70 (48%), Gaps = 1/70 (1%) Query 6 SSKVESFETDPYYGVQFRVLDLPQHHAVAMTVLTASPNAFRMPPPLLHIPKASELEILPG 65 S +E+ + +YG ++V+D P M +P A +P P + +++ + G Sbjct 493 SRSLETDSAEKWYGTAYKVVDYPADLIKNMKSPGLNP-ALTLPRPNEFVSTNFKVDKIDG 551 Query 66 LLGLNEPELI 75 + L+EP L+ Sbjct 552 IKPLDEPVLL 561 > dre:336319 fj63c11; wu:fj63c11 Length=801 Score = 27.7 bits (60), Expect = 9.0, Method: Compositional matrix adjust. Identities = 13/27 (48%), Positives = 18/27 (66%), Gaps = 0/27 (0%) Query 63 LPGLLGLNEPELISEQGGNAGTAVWWQ 89 L GLL + P LI + NAGTA+W++ Sbjct 745 LVGLLPVPHPILIRKYQANAGTAMWFR 771 > xla:100125672 c17orf28; chromosome 17 open reading frame 28 Length=792 Score = 27.7 bits (60), Expect = 9.1, Method: Compositional matrix adjust. Identities = 13/27 (48%), Positives = 18/27 (66%), Gaps = 0/27 (0%) Query 63 LPGLLGLNEPELISEQGGNAGTAVWWQ 89 L GLL + P LI + NAGTA+W++ Sbjct 736 LVGLLPVPHPILIRKYQANAGTAMWFR 762 > ath:AT2G05070 LHCB2.2; chlorophyll binding; K08913 light-harvesting complex II chlorophyll a/b binding protein 2 Length=265 Score = 27.7 bits (60), Expect = 9.9, Method: Compositional matrix adjust. Identities = 20/70 (28%), Positives = 30/70 (42%), Gaps = 15/70 (21%) Query 26 DLPQHHAVAMTVLTASPNAFRMPPPLLHIPKASELEILP------GLLGLNEPELISEQG 79 + P + L+A P F K ELE++ G LG PE++S+ G Sbjct 72 EYPGDYGWDTAGLSADPETF---------AKNRELEVIHSRWAMLGALGCTFPEILSKNG 122 Query 80 GNAGTAVWWQ 89 G AVW++ Sbjct 123 VKFGEAVWFK 132 Lambda K H 0.316 0.134 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2067351240 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40