bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_6470_orf2 Length=70 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_043920 DNA replication licensing factor, putative ;... 61.2 7e-10 bbo:BBOV_IV010040 23.m06024; DNA replication licensing factor ... 45.4 4e-05 pfa:PFL0580w DNA replication licensing factor MCM5, putative; ... 35.4 0.049 tpv:TP01_0722 DNA replication licensing factor MCM5; K02209 mi... 33.5 0.16 hsa:4174 MCM5, CDC46, MGC5315, P1-CDC46; minichromosome mainte... 32.3 0.34 xla:379699 mcm5-b, MGC68977, cdc46, xmcm5; minichromosome main... 32.0 0.51 mmu:17218 Mcm5, AA617332, AI324988, AL033333, Cdc46, Mcmd5, P1... 31.6 0.60 xla:380587 mcm5-a, MGC53425, cdc46, mcm5, xmcm5; minichromosom... 31.2 0.78 mmu:83669 Wdr6, mWDR6; WD repeat domain 6 30.0 ath:AT1G44900 ATP binding / DNA binding / DNA-dependent ATPase... 30.0 1.8 ath:AT2G16440 DNA replication licensing factor, putative; K022... 29.6 2.2 pfa:PF14_0177 DNA replication licensing factor MCM2; K02540 mi... 29.3 2.8 cpv:cgd2_1250 DNA replication licensing factor MCM4 like AAA+ ... 29.3 3.4 sce:YBL023C MCM2; Mcm2p; K02540 minichromosome maintenance pro... 29.3 3.5 sce:YGL201C MCM6; Mcm6p; K02542 minichromosome maintenance pro... 28.9 4.1 tgo:TGME49_037220 DNA replication licensing factor, putative (... 28.9 4.3 cpv:cgd7_2920 DNA replication licensing factor MCM5 like AAA+ ... 28.9 4.6 > tgo:TGME49_043920 DNA replication licensing factor, putative ; K02209 minichromosome maintenance protein 5 (cell division control protein 46) Length=794 Score = 61.2 bits (147), Expect = 7e-10, Method: Compositional matrix adjust. Identities = 30/68 (44%), Positives = 46/68 (67%), Gaps = 5/68 (7%) Query 6 NVAAERYDQSVPQQAYIHVLGIKKINFSPLLST---LTSLEQRSLFQRLSQEPNIIDKIA 62 + ++ DQ P +Y+HVLG++K++F L T T EQR +F +L+Q NI+DKIA Sbjct 345 HTGSKETDQ--PHSSYLHVLGLQKVSFMSLARTRLSFTQTEQRDVFYKLAQSQNILDKIA 402 Query 63 RSIAPALF 70 +S+APAL+ Sbjct 403 KSLAPALY 410 > bbo:BBOV_IV010040 23.m06024; DNA replication licensing factor MCM5; K02209 minichromosome maintenance protein 5 (cell division control protein 46) Length=777 Score = 45.4 bits (106), Expect = 4e-05, Method: Compositional matrix adjust. Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 0/65 (0%) Query 6 NVAAERYDQSVPQQAYIHVLGIKKINFSPLLSTLTSLEQRSLFQRLSQEPNIIDKIARSI 65 NV A D + +Y+HVLGI+K+ + LE+ + L+ +P+I DKI RSI Sbjct 331 NVNARGNDSTAIGSSYLHVLGIEKLTQGKGEAISFDLEETNDLVLLATQPDIHDKIFRSI 390 Query 66 APALF 70 APA++ Sbjct 391 APAIY 395 > pfa:PFL0580w DNA replication licensing factor MCM5, putative; K02209 minichromosome maintenance protein 5 (cell division control protein 46) Length=758 Score = 35.4 bits (80), Expect = 0.049, Method: Compositional matrix adjust. Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 0/51 (0%) Query 20 AYIHVLGIKKINFSPLLSTLTSLEQRSLFQRLSQEPNIIDKIARSIAPALF 70 +Y+HVLG +K + +E+R+ L+ E NI +KI +SIAP L+ Sbjct 328 SYLHVLGFQKYDDMSGNDLNFDVEERNELTLLAAEHNIHEKIFKSIAPELY 378 > tpv:TP01_0722 DNA replication licensing factor MCM5; K02209 minichromosome maintenance protein 5 (cell division control protein 46) Length=767 Score = 33.5 bits (75), Expect = 0.16, Method: Compositional matrix adjust. Identities = 17/51 (33%), Positives = 32/51 (62%), Gaps = 2/51 (3%) Query 20 AYIHVLGIKKINFSPLLSTLTSLEQRSLFQRLSQEPNIIDKIARSIAPALF 70 +Y+HVLGI+K+N + +++ + L+ +P+I KI SIAP+++ Sbjct 337 SYLHVLGIQKLNVNETYE--FDIDEGNDLLLLASQPDIHTKIFNSIAPSIY 385 > hsa:4174 MCM5, CDC46, MGC5315, P1-CDC46; minichromosome maintenance complex component 5; K02209 minichromosome maintenance protein 5 (cell division control protein 46) Length=734 Score = 32.3 bits (72), Expect = 0.34, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 32/55 (58%), Gaps = 2/55 (3%) Query 18 QQAYIHVLGIK--KINFSPLLSTLTSLEQRSLFQRLSQEPNIIDKIARSIAPALF 70 + +YI VLGI+ + S ++ F+RL+ PN+ + I++SIAP++F Sbjct 290 RSSYIRVLGIQVDTDGSGRSFAGAVSPQEEEEFRRLAALPNVYEVISKSIAPSIF 344 > xla:379699 mcm5-b, MGC68977, cdc46, xmcm5; minichromosome maintenance complex component 5 (EC:3.6.4.12); K02209 minichromosome maintenance protein 5 (cell division control protein 46) Length=735 Score = 32.0 bits (71), Expect = 0.51, Method: Composition-based stats. Identities = 18/56 (32%), Positives = 35/56 (62%), Gaps = 4/56 (7%) Query 18 QQAYIHVLGIK---KINFSPLLSTLTSLEQRSLFQRLSQEPNIIDKIARSIAPALF 70 + +YI V+GI+ + T+T E+ F+RL+ +P+I + +A+SIAP+++ Sbjct 291 RSSYIRVVGIQVDTEGTGRSAAGTITPQEEEE-FRRLAVKPDIYETVAKSIAPSIY 345 > mmu:17218 Mcm5, AA617332, AI324988, AL033333, Cdc46, Mcmd5, P1-CDC46, mCD46, mCDC46; minichromosome maintenance deficient 5, cell division cycle 46 (S. cerevisiae) (EC:3.6.4.12); K02209 minichromosome maintenance protein 5 (cell division control protein 46) Length=734 Score = 31.6 bits (70), Expect = 0.60, Method: Composition-based stats. Identities = 19/55 (34%), Positives = 33/55 (60%), Gaps = 2/55 (3%) Query 18 QQAYIHVLGIKKINFSPLLSTLTSL--EQRSLFQRLSQEPNIIDKIARSIAPALF 70 + +YI VLGI+ S S+ ++ F+RL+ PNI + I++SI+P++F Sbjct 290 RSSYIRVLGIQVDTDGSGRSFAGSVSPQEEEEFRRLAALPNIYELISKSISPSIF 344 > xla:380587 mcm5-a, MGC53425, cdc46, mcm5, xmcm5; minichromosome maintenance complex component 5 (EC:3.6.4.12); K02209 minichromosome maintenance protein 5 (cell division control protein 46) Length=735 Score = 31.2 bits (69), Expect = 0.78, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 34/55 (61%), Gaps = 2/55 (3%) Query 18 QQAYIHVLGIKKINFSPLLSTLTSL--EQRSLFQRLSQEPNIIDKIARSIAPALF 70 + +YI V+GI+ S ++ ++ F+RL+ +P+I + +A+SIAP+++ Sbjct 291 RSSYIRVVGIQVDTEGTGRSAAGAITPQEEEEFRRLAAKPDIYETVAKSIAPSIY 345 > mmu:83669 Wdr6, mWDR6; WD repeat domain 6 Length=1125 Score = 30.0 bits (66), Expect = 1.7, Method: Composition-based stats. Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Query 13 DQSVPQQAYIHVLGIKKINFSPLLSTLTSLEQRSLFQRLSQ-EPNIID 59 + SVP HV G+K + SP L S++QR F RL Q EP ++ Sbjct 1041 EYSVPCAHAAHVTGVKIL--SPKLMVSASIDQRLTFWRLGQGEPTFMN 1086 > ath:AT1G44900 ATP binding / DNA binding / DNA-dependent ATPase; K02540 minichromosome maintenance protein 2 Length=936 Score = 30.0 bits (66), Expect = 1.8, Method: Compositional matrix adjust. Identities = 10/28 (35%), Positives = 22/28 (78%), Gaps = 0/28 (0%) Query 43 EQRSLFQRLSQEPNIIDKIARSIAPALF 70 E ++ + LS++P I+++I +SIAP+++ Sbjct 485 EDKTQIEELSKDPRIVERIIKSIAPSIY 512 > ath:AT2G16440 DNA replication licensing factor, putative; K02212 minichromosome maintenance protein 4 (cell division control protein 54) Length=847 Score = 29.6 bits (65), Expect = 2.2, Method: Compositional matrix adjust. Identities = 10/23 (43%), Positives = 20/23 (86%), Gaps = 0/23 (0%) Query 48 FQRLSQEPNIIDKIARSIAPALF 70 FQ LS++P+I ++++RS+AP ++ Sbjct 426 FQELSKQPDIYERLSRSLAPNIW 448 > pfa:PF14_0177 DNA replication licensing factor MCM2; K02540 minichromosome maintenance protein 2 Length=971 Score = 29.3 bits (64), Expect = 2.8, Method: Compositional matrix adjust. Identities = 15/35 (42%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Query 36 LSTLTSLEQRSLFQRLSQEPNIIDKIARSIAPALF 70 LS LT + + + +LS++PNI ++I SIAPA++ Sbjct 466 LSELTEDDIKDIL-KLSKDPNIRERIITSIAPAIW 499 > cpv:cgd2_1250 DNA replication licensing factor MCM4 like AAA+ ATpase ; K02212 minichromosome maintenance protein 4 (cell division control protein 54) Length=896 Score = 29.3 bits (64), Expect = 3.4, Method: Composition-based stats. Identities = 13/40 (32%), Positives = 27/40 (67%), Gaps = 8/40 (20%) Query 39 LTSLEQRSLFQR--------LSQEPNIIDKIARSIAPALF 70 + S+E+ +LF + +S++P + DK++RSIAP+++ Sbjct 424 INSVEKNNLFTKEMIEQFHAMSKDPMLYDKLSRSIAPSIW 463 > sce:YBL023C MCM2; Mcm2p; K02540 minichromosome maintenance protein 2 Length=868 Score = 29.3 bits (64), Expect = 3.5, Method: Compositional matrix adjust. Identities = 13/33 (39%), Positives = 24/33 (72%), Gaps = 1/33 (3%) Query 38 TLTSLEQRSLFQRLSQEPNIIDKIARSIAPALF 70 + T E+R F+++S++ IIDKI S+AP+++ Sbjct 475 SWTEEEERE-FRKISRDRGIIDKIISSMAPSIY 506 > sce:YGL201C MCM6; Mcm6p; K02542 minichromosome maintenance protein 6 Length=1017 Score = 28.9 bits (63), Expect = 4.1, Method: Compositional matrix adjust. Identities = 15/36 (41%), Positives = 25/36 (69%), Gaps = 1/36 (2%) Query 35 LLSTLTSLEQRSLFQRLSQEPNIIDKIARSIAPALF 70 L++L+S E L + + ++ +I DK+ RSIAPA+F Sbjct 504 FLNSLSSDEINEL-KEMVKDEHIYDKLVRSIAPAVF 538 > tgo:TGME49_037220 DNA replication licensing factor, putative (EC:6.6.1.1); K02210 minichromosome maintenance protein 7 (cell division control protein 47) Length=865 Score = 28.9 bits (63), Expect = 4.3, Method: Composition-based stats. Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 6/48 (12%) Query 29 KINFSPLLSTLTSLEQRSLFQ------RLSQEPNIIDKIARSIAPALF 70 +++F L T L++R Q +L Q P + D +ARSIAP ++ Sbjct 385 EVSFIQLKKQQTHLDRRESLQIAEKVAKLRQTPGLYDLLARSIAPGVY 432 > cpv:cgd7_2920 DNA replication licensing factor MCM5 like AAA+ ATpase ; K02209 minichromosome maintenance protein 5 (cell division control protein 46) Length=791 Score = 28.9 bits (63), Expect = 4.6, Method: Compositional matrix adjust. Identities = 20/65 (30%), Positives = 36/65 (55%), Gaps = 14/65 (21%) Query 18 QQAYIHVLGIKKINFSPLLS---TLTSLEQRSL---------FQRLSQEPNIIDKIARSI 65 + +Y++V+G+ +N+ S T T ++ S+ F+R+S PNI + I SI Sbjct 338 RTSYLYVIGV--MNYGSSWSNKNTNTLIKNSSISNQYNEIEEFRRISSLPNIHELIVNSI 395 Query 66 APALF 70 APA++ Sbjct 396 APAIY 400 Lambda K H 0.317 0.131 0.351 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2024947620 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40