bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_6583_orf3 Length=60 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_032590 gamma-glutamylcysteine synthetase, putative ... 72.8 3e-13 pfa:PFI0925w gamma-glutamylcysteine synthetase (EC:6.3.2.2); K... 63.5 2e-10 xla:100137615 gclc; glutamate-cysteine ligase, catalytic subun... 58.9 4e-09 xla:100049719 glutamate-cysteine ligase, catalytic subunit (EC... 58.5 5e-09 cel:F37B12.2 gcs-1; gamma GlutamylCysteine Synthetase family m... 58.2 6e-09 mmu:14629 Gclc, D9Wsu168e, GLCL-H, Ggcs-hs, Glclc; glutamate-c... 56.6 2e-08 hsa:2729 GCLC, GCL, GCS, GLCL, GLCLC; glutamate-cysteine ligas... 55.8 3e-08 dre:326857 gclc, cb1049, fe36e11, wu:fe36e11; glutamate-cystei... 55.5 4e-08 bbo:BBOV_I002580 19.m02298; glutamate-cysteine ligase catalyti... 48.9 4e-06 sce:YJL101C GSH1; Gamma glutamylcysteine synthetase catalyzes ... 47.4 1e-05 tpv:TP03_0084 gamma-glutamylcysteine synthetase (EC:6.3.2.2); ... 41.6 7e-04 > tgo:TGME49_032590 gamma-glutamylcysteine synthetase, putative (EC:6.3.2.2); K11204 glutamate--cysteine ligase catalytic subunit [EC:6.3.2.2] Length=1062 Score = 72.8 bits (177), Expect = 3e-13, Method: Composition-based stats. Identities = 36/60 (60%), Positives = 44/60 (73%), Gaps = 0/60 (0%) Query 1 YDQLIVLAALMMLITAGTPFLRGCVAATDTRWDTISMSVDSRKPEEKQKITKSRYSSNSL 60 YDQL VLA L + +TA TPFLRG VAATDTRW TI+ +VD R +E + + KSRY + SL Sbjct 399 YDQLGVLAPLWLSLTAATPFLRGLVAATDTRWATIAGAVDCRTSKESRALPKSRYGAFSL 458 > pfa:PFI0925w gamma-glutamylcysteine synthetase (EC:6.3.2.2); K11204 glutamate--cysteine ligase catalytic subunit [EC:6.3.2.2] Length=1063 Score = 63.5 bits (153), Expect = 2e-10, Method: Composition-based stats. Identities = 33/60 (55%), Positives = 38/60 (63%), Gaps = 0/60 (0%) Query 1 YDQLIVLAALMMLITAGTPFLRGCVAATDTRWDTISMSVDSRKPEEKQKITKSRYSSNSL 60 YDQL V+A L + +TA TP+L G + TDTRW IS SVD R EE I K RYS SL Sbjct 546 YDQLAVIAPLFLALTACTPYLGGFLTETDTRWRVISNSVDCRTEEELSYICKPRYSGISL 605 > xla:100137615 gclc; glutamate-cysteine ligase, catalytic subunit (EC:6.3.2.2); K11204 glutamate--cysteine ligase catalytic subunit [EC:6.3.2.2] Length=637 Score = 58.9 bits (141), Expect = 4e-09, Method: Composition-based stats. Identities = 30/66 (45%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Query 1 YDQLIVLAALMMLITAGTPFLRGCVAATDTRWDTISMSVDSRKPEE---------KQKIT 51 YDQL + +MM ++A PF RG V+ D RW IS SVD R EE K +I+ Sbjct 267 YDQLATICPIMMALSAAAPFYRGYVSDIDCRWGVISASVDDRTKEERGLEPLKNSKYRIS 326 Query 52 KSRYSS 57 KSRY S Sbjct 327 KSRYDS 332 > xla:100049719 glutamate-cysteine ligase, catalytic subunit (EC:6.3.2.2) Length=637 Score = 58.5 bits (140), Expect = 5e-09, Method: Composition-based stats. Identities = 30/66 (45%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Query 1 YDQLIVLAALMMLITAGTPFLRGCVAATDTRWDTISMSVDSRKPEE---------KQKIT 51 YDQL + +MM ++A PF RG V+ D RW IS SVD R EE K +I+ Sbjct 267 YDQLATICPIMMALSAAAPFYRGYVSDIDCRWGVISASVDDRTKEERGLEPLKNNKYRIS 326 Query 52 KSRYSS 57 KSRY S Sbjct 327 KSRYDS 332 > cel:F37B12.2 gcs-1; gamma GlutamylCysteine Synthetase family member (gcs-1); K11204 glutamate--cysteine ligase catalytic subunit [EC:6.3.2.2] Length=654 Score = 58.2 bits (139), Expect = 6e-09, Method: Composition-based stats. Identities = 29/66 (43%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Query 1 YDQLIVLAALMMLITAGTPFLRGCVAATDTRWDTISMSVDSRKPEE---------KQKIT 51 YDQL + +++ ++A TP RG ++ D+RWD IS SVD R PEE K I Sbjct 271 YDQLTPITPILLALSAATPIFRGKLSNVDSRWDIISASVDDRTPEERGLEPLKNSKWVID 330 Query 52 KSRYSS 57 KSRY S Sbjct 331 KSRYDS 336 > mmu:14629 Gclc, D9Wsu168e, GLCL-H, Ggcs-hs, Glclc; glutamate-cysteine ligase, catalytic subunit (EC:6.3.2.2); K11204 glutamate--cysteine ligase catalytic subunit [EC:6.3.2.2] Length=637 Score = 56.6 bits (135), Expect = 2e-08, Method: Composition-based stats. Identities = 28/66 (42%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Query 1 YDQLIVLAALMMLITAGTPFLRGCVAATDTRWDTISMSVDSRKPEEKQ---------KIT 51 YDQL + ++M ++A +PF RG V+ D RW IS SVD R EE+ +I+ Sbjct 266 YDQLATICPIVMALSAASPFYRGYVSDIDCRWGVISASVDDRTREERGLEPLKNNRFRIS 325 Query 52 KSRYSS 57 KSRY S Sbjct 326 KSRYDS 331 > hsa:2729 GCLC, GCL, GCS, GLCL, GLCLC; glutamate-cysteine ligase, catalytic subunit (EC:6.3.2.2); K11204 glutamate--cysteine ligase catalytic subunit [EC:6.3.2.2] Length=599 Score = 55.8 bits (133), Expect = 3e-08, Method: Composition-based stats. Identities = 28/66 (42%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Query 1 YDQLIVLAALMMLITAGTPFLRGCVAATDTRWDTISMSVDSRKPEEK---------QKIT 51 YDQL + ++M ++A +PF RG V+ D RW IS SVD R EE+ +I+ Sbjct 228 YDQLATICPIVMALSAASPFYRGYVSDIDCRWGVISASVDDRTREERGLEPLKNNNYRIS 287 Query 52 KSRYSS 57 KSRY S Sbjct 288 KSRYDS 293 > dre:326857 gclc, cb1049, fe36e11, wu:fe36e11; glutamate-cysteine ligase, catalytic subunit (EC:6.3.2.2); K11204 glutamate--cysteine ligase catalytic subunit [EC:6.3.2.2] Length=631 Score = 55.5 bits (132), Expect = 4e-08, Method: Composition-based stats. Identities = 29/66 (43%), Positives = 36/66 (54%), Gaps = 9/66 (13%) Query 1 YDQLIVLAALMMLITAGTPFLRGCVAATDTRWDTISMSVDSRKPEE---------KQKIT 51 YDQL ++M ++A +PF RG V+ D RW IS SVD R EE K +I Sbjct 267 YDQLATFCPIVMALSAASPFYRGFVSDIDCRWGVISASVDDRTREERGLESLKNNKFRIH 326 Query 52 KSRYSS 57 KSRY S Sbjct 327 KSRYDS 332 > bbo:BBOV_I002580 19.m02298; glutamate-cysteine ligase catalytic subunit (EC:6.3.2.2); K11204 glutamate--cysteine ligase catalytic subunit [EC:6.3.2.2] Length=685 Score = 48.9 bits (115), Expect = 4e-06, Method: Composition-based stats. Identities = 27/60 (45%), Positives = 40/60 (66%), Gaps = 0/60 (0%) Query 1 YDQLIVLAALMMLITAGTPFLRGCVAATDTRWDTISMSVDSRKPEEKQKITKSRYSSNSL 60 YDQL VLA L + +TA T +G +++ TRW +S SVD R+ EE +++ SR+S+ SL Sbjct 359 YDQLTVLAPLFLALTAATAAHKGLMSSHTTRWRVLSQSVDDRRDEEHERVPFSRFSTVSL 418 > sce:YJL101C GSH1; Gamma glutamylcysteine synthetase catalyzes the first step in glutathione (GSH) biosynthesis; expression induced by oxidants, cadmium, and mercury (EC:6.3.2.2); K11204 glutamate--cysteine ligase catalytic subunit [EC:6.3.2.2] Length=678 Score = 47.4 bits (111), Expect = 1e-05, Method: Composition-based stats. Identities = 19/47 (40%), Positives = 29/47 (61%), Gaps = 0/47 (0%) Query 1 YDQLIVLAALMMLITAGTPFLRGCVAATDTRWDTISMSVDSRKPEEK 47 YD L+ A +M+ +A P +G +A D RW+ IS +VD R P+E+ Sbjct 283 YDALVNFAPIMLAFSAAAPAFKGWLADQDVRWNVISGAVDDRTPKER 329 > tpv:TP03_0084 gamma-glutamylcysteine synthetase (EC:6.3.2.2); K11204 glutamate--cysteine ligase catalytic subunit [EC:6.3.2.2] Length=867 Score = 41.6 bits (96), Expect = 7e-04, Method: Composition-based stats. Identities = 18/60 (30%), Positives = 34/60 (56%), Gaps = 0/60 (0%) Query 1 YDQLIVLAALMMLITAGTPFLRGCVAATDTRWDTISMSVDSRKPEEKQKITKSRYSSNSL 60 +DQLI L + + +++ T RG ++ D RW + ++D +++ I K RY++ SL Sbjct 493 HDQLIPLTPIFLSLSSATVAFRGELSNIDNRWPVLVQAMDDLDDQDRSYILKGRYNTTSL 552 Lambda K H 0.318 0.128 0.362 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2069361540 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40