bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_6626_orf3 Length=177 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_066400 hypothetical protein ; K14790 nucleolar prot... 64.7 2e-10 cpv:cgd5_2990 hypothetical protein 29.6 6.1 pfa:PF11_0342 conserved Plasmodium protein 29.3 7.6 > tgo:TGME49_066400 hypothetical protein ; K14790 nucleolar protein 9 Length=960 Score = 64.7 bits (156), Expect = 2e-10, Method: Composition-based stats. Identities = 51/176 (28%), Positives = 91/176 (51%), Gaps = 15/176 (8%) Query 12 KNYTAYMKCEIYKFTKDKEEWQKRQEKRSKTRELFKDIISDAAIEVNNQEAADLLPDNPK 71 KNY AY+ CEI+ F +++E W RQEK+SKTRELFKD++++ + + A+ + Sbjct 739 KNYAAYVNCEIHTFKRNEEGWATRQEKKSKTRELFKDLLAEEGDQAEDVVEAEKTEKHAA 798 Query 72 GKKAEA--ESTPLQNEGKGFRK---------PKNENKNKKGTINGDEEEEINTKGKAEKE 120 + A A E + + G + + + + + +GD EE +T + KE Sbjct 799 HEAARALLERDAVAQQLLGVDEKKKSKKTVEKRKKKQAPESDSDGDVFEESST---SRKE 855 Query 121 AKRAIDEIFLGAFEEKQKGKENKKKKQLTGKAKENSNPPAPSNENENANLNKTKNK 176 A+ A+D IF A +E QKGK + K + T A ++++ + ++ + + + K Sbjct 856 AQEAVDTIFSEAAKE-QKGKRRRTKTEQTELADQDADGASAADSSSGTSKKRKGEK 910 > cpv:cgd5_2990 hypothetical protein Length=764 Score = 29.6 bits (65), Expect = 6.1, Method: Compositional matrix adjust. Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Query 9 LREKNYTAYMKCEIYKFTKDKEEWQKRQEKRSKTRELFKDII 50 L KN+ + +I F K K++W EK KTR+LF +II Sbjct 660 LMSKNFKIFKSLKIESFNK-KDDWNNVNEKIDKTRKLFSNII 700 > pfa:PF11_0342 conserved Plasmodium protein Length=2072 Score = 29.3 bits (64), Expect = 7.6, Method: Compositional matrix adjust. Identities = 30/100 (30%), Positives = 48/100 (48%), Gaps = 3/100 (3%) Query 66 LPDNPKGKKAEAESTPLQNEGKGFRKPKNENKNKKGTINGDEEEEINTKGKAEKEAKRAI 125 + D+ + + TP +N+GK KN + + ++ +N G+ +K+ R I Sbjct 307 ILDDSSNIQFHKKETPSKNQGKNKYIFKNVERKNTAVYDKNKNTSLNNYGQQQKKINR-I 365 Query 126 DEIFLGAFEEKQKGKENKKKKQLTGKAKENSNPPAPSNEN 165 DEIF EK+K KE ++K L K N N +NEN Sbjct 366 DEIFKNLI-EKRKKKEMRQKYMLKKKFLMN-NYKGKTNEN 403 Lambda K H 0.301 0.123 0.330 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 4665550176 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40