bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_6679_orf1 Length=115 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_078110 1,3-beta-glucan synthase component domain-co... 89.7 2e-18 mmu:328783 Mslnl, 4732467B22; mesothelin-like 29.6 2.2 ath:AT4G18720 transcription elongation factor-related 29.6 2.4 ath:AT2G36850 GSL8; GSL8 (GLUCAN SYNTHASE-LIKE 8); 1,3-beta-gl... 29.3 3.0 sce:YGR230W BNS1; Bns1p 29.3 3.3 dre:562011 shc2, MGC162768, si:dkey-94n12.3, zgc:162768; SHC (... 28.1 6.7 dre:100002347 hypothetical LOC100002347 27.7 8.5 > tgo:TGME49_078110 1,3-beta-glucan synthase component domain-containing protein (EC:2.4.1.34); K00706 1,3-beta-glucan synthase [EC:2.4.1.34] Length=2321 Score = 89.7 bits (221), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 44/103 (42%), Positives = 67/103 (65%), Gaps = 3/103 (2%) Query 15 DARPKDEKPRRMG---LSVSRENLNAVIAELSCSSKPGSGVKTFVEHRTYAQVLRNFWRV 71 DA +++P G LS +RENLN + +L +KP G+KTF+E RTY QVLR+FWRV Sbjct 277 DASIAEDRPGTSGGPRLSFTRENLNMFVHKLLNGTKPSEGIKTFMERRTYLQVLRSFWRV 336 Query 72 FAWHVTTFAGILLLYAVVDEESSYSVSKQWSILTLTAILSYGM 114 AWH TF+ + L AVVD+ES+ ++ W+ +T+++ + + Sbjct 337 IAWHGVTFSLLFFLKAVVDDESTAELAFTWNRTVVTSVVLHAL 379 > mmu:328783 Mslnl, 4732467B22; mesothelin-like Length=685 Score = 29.6 bits (65), Expect = 2.2, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Query 3 DTRSFSDSFLRSDARPKDEKP-RRMGLSVSRENLNA 37 D R F D+FL S A +P RR G S R N+ A Sbjct 283 DARRFVDNFLESKATSVSSRPKRRTGRSCVRGNITA 318 > ath:AT4G18720 transcription elongation factor-related Length=266 Score = 29.6 bits (65), Expect = 2.4, Method: Compositional matrix adjust. Identities = 11/48 (22%), Positives = 27/48 (56%), Gaps = 5/48 (10%) Query 32 RENLNAVIAELSCSSKPGSGVKTFVEH-----RTYAQVLRNFWRVFAW 74 +E +++ ++ C + G G++ F++H R+ ++LR+ W F + Sbjct 40 KEAPKSLVCDVVCKTSMGQGLEFFIDHKNPKIRSEGRILRDLWMKFFY 87 > ath:AT2G36850 GSL8; GSL8 (GLUCAN SYNTHASE-LIKE 8); 1,3-beta-glucan synthase/ transferase, transferring glycosyl groups; K11000 callose synthase [EC:2.4.1.-] Length=1909 Score = 29.3 bits (64), Expect = 3.0, Method: Compositional matrix adjust. Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 4/44 (9%) Query 46 SKPGSGVKT----FVEHRTYAQVLRNFWRVFAWHVTTFAGILLL 85 SKP +T FVEHRTY + R+F R++ + F + ++ Sbjct 466 SKPKGRKRTAKSSFVEHRTYLHLFRSFIRLWIFMFIMFQSLTII 509 > sce:YGR230W BNS1; Bns1p Length=137 Score = 29.3 bits (64), Expect = 3.3, Method: Compositional matrix adjust. Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 0/38 (0%) Query 33 ENLNAVIAELSCSSKPGSGVKTFVEHRTYAQVLRNFWR 70 ENL++ L S K KTF +H + QV +N +R Sbjct 31 ENLDSFNQHLKMSLKVAHNTKTFAKHCLHRQVFKNTYR 68 > dre:562011 shc2, MGC162768, si:dkey-94n12.3, zgc:162768; SHC (Src homology 2 domain containing) transforming protein 2; K06279 src homology 2 domain-containing transforming protein C Length=501 Score = 28.1 bits (61), Expect = 6.7, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Query 8 SDSFLRSDARPKDEKPRRMGLSVSRENLNAVIAELSCSSKPGSGVKTFVEHRTYAQVLR 66 SD +LR+D P + L V+ +NL+ + A + +P S K + R + LR Sbjct 313 SDGYLRADGHPPGSRDYEEHLYVNTQNLDNLEASV-VGRRPESPKKDIFDMRPFEDALR 370 > dre:100002347 hypothetical LOC100002347 Length=343 Score = 27.7 bits (60), Expect = 8.5, Method: Compositional matrix adjust. Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 0/48 (0%) Query 23 PRRMGLSVSRENLNAVIAELSCSSKPGSGVKTFVEHRTYAQVLRNFWR 70 PR L + R + + + +KP S V F +RT +VLR W+ Sbjct 155 PRDRELGIERAHRALQLKPSNPEAKPRSKVVKFSSYRTKEEVLRKAWQ 202 Lambda K H 0.320 0.130 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2042676840 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40