bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_6709_orf2 Length=51 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_005220 U5 snRNP-associated 102 kDa protein, putativ... 73.2 2e-13 ath:AT4G03430 EMB2770 (EMBRYO DEFECTIVE 2770); RNA splicing fa... 54.7 7e-08 dre:323855 c20orf14, fc12b02, prpf6, wu:fa05f07, wu:fc12b02, z... 53.5 2e-07 tpv:TP01_0797 hypothetical protein; K12855 pre-mRNA-processing... 49.3 3e-06 pfa:PF11_0108 U5 snRNP-associated protein, putative; K12855 pr... 48.9 4e-06 xla:447198 prpf6, MGC80263; PRP6 pre-mRNA processing factor 6 ... 47.8 1e-05 mmu:68879 Prpf6, 1190003A07Rik, 2610031L17Rik, ANT-1, MGC11655... 46.6 2e-05 hsa:24148 PRPF6, ANT-1, C20orf14, Prp6, TOM, U5-102K, hPrp6; P... 46.6 2e-05 bbo:BBOV_IV009720 23.m06014; u5 snRNP-associated subunit, puta... 38.1 0.007 cel:Y59A8B.6 hypothetical protein; K12855 pre-mRNA-processing ... 34.3 0.10 hsa:653889 pre-mRNA-processing factor 6-like 28.1 7.8 > tgo:TGME49_005220 U5 snRNP-associated 102 kDa protein, putative ; K12855 pre-mRNA-processing factor 6 Length=985 Score = 73.2 bits (178), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 34/51 (66%), Positives = 40/51 (78%), Gaps = 0/51 (0%) Query 1 FFKTAQAIIRAAIKEGVENINAKRVWSEDAEECLSRGSITVARALYTHALE 51 F T QAI+RA +K GVE +NAKR+W EDAEE LSRGS+ ARALYT A+E Sbjct 584 FMATCQAIVRATMKVGVEGMNAKRIWKEDAEEALSRGSVATARALYTCAIE 634 > ath:AT4G03430 EMB2770 (EMBRYO DEFECTIVE 2770); RNA splicing factor, transesterification mechanism; K12855 pre-mRNA-processing factor 6 Length=1029 Score = 54.7 bits (130), Expect = 7e-08, Method: Compositional matrix adjust. Identities = 27/47 (57%), Positives = 31/47 (65%), Gaps = 0/47 (0%) Query 4 TAQAIIRAAIKEGVENINAKRVWSEDAEECLSRGSITVARALYTHAL 50 T QAII+ I GVE + KR W DA+EC RGSI ARA+Y HAL Sbjct 606 TCQAIIKNTIGIGVEEEDRKRTWVADADECKKRGSIETARAIYAHAL 652 > dre:323855 c20orf14, fc12b02, prpf6, wu:fa05f07, wu:fc12b02, zgc:65913; c20orf14 homolog (H. sapiens); K12855 pre-mRNA-processing factor 6 Length=944 Score = 53.5 bits (127), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 23/48 (47%), Positives = 33/48 (68%), Gaps = 0/48 (0%) Query 4 TAQAIIRAAIKEGVENINAKRVWSEDAEECLSRGSITVARALYTHALE 51 T Q++IRA I G+E + K W EDA+ C+S G++ ARA+Y HAL+ Sbjct 524 TCQSVIRAVIGIGIEEEDCKHTWMEDADSCVSHGALECARAIYAHALQ 571 > tpv:TP01_0797 hypothetical protein; K12855 pre-mRNA-processing factor 6 Length=1032 Score = 49.3 bits (116), Expect = 3e-06, Method: Composition-based stats. Identities = 26/51 (50%), Positives = 32/51 (62%), Gaps = 0/51 (0%) Query 1 FFKTAQAIIRAAIKEGVENINAKRVWSEDAEECLSRGSITVARALYTHALE 51 F KTAQ+II+ + GV+ N K VW ED E + GS ARALY +ALE Sbjct 523 FVKTAQSIIKNTMTIGVDEHNRKSVWLEDGETFVEHGSYECARALYKNALE 573 > pfa:PF11_0108 U5 snRNP-associated protein, putative; K12855 pre-mRNA-processing factor 6 Length=1329 Score = 48.9 bits (115), Expect = 4e-06, Method: Composition-based stats. Identities = 22/51 (43%), Positives = 32/51 (62%), Gaps = 0/51 (0%) Query 1 FFKTAQAIIRAAIKEGVENINAKRVWSEDAEECLSRGSITVARALYTHALE 51 F T ++IIR + GVE +N KR++ +DA+ C+ SI AR LY AL+ Sbjct 634 FTHTCESIIRNTMHIGVETLNKKRIYKQDAQNCIHNKSIHTARTLYNEALK 684 > xla:447198 prpf6, MGC80263; PRP6 pre-mRNA processing factor 6 homolog; K12855 pre-mRNA-processing factor 6 Length=948 Score = 47.8 bits (112), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 21/48 (43%), Positives = 31/48 (64%), Gaps = 0/48 (0%) Query 4 TAQAIIRAAIKEGVENINAKRVWSEDAEECLSRGSITVARALYTHALE 51 T QAIIR I G+E + K W EDA+ C++ ++ ARA+Y H+L+ Sbjct 528 TCQAIIRDVIGIGIEEEDRKHTWMEDADSCVAHSALECARAIYAHSLQ 575 > mmu:68879 Prpf6, 1190003A07Rik, 2610031L17Rik, ANT-1, MGC11655, MGC36967, MGC38351, U5-102K; PRP6 pre-mRNA splicing factor 6 homolog (yeast); K12855 pre-mRNA-processing factor 6 Length=941 Score = 46.6 bits (109), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 20/48 (41%), Positives = 32/48 (66%), Gaps = 0/48 (0%) Query 4 TAQAIIRAAIKEGVENINAKRVWSEDAEECLSRGSITVARALYTHALE 51 T QA++RA I G+E + K W EDA+ C++ ++ ARA+Y +AL+ Sbjct 521 TCQAVMRAVIGIGIEEEDRKHTWMEDADSCVAHNALECARAIYAYALQ 568 > hsa:24148 PRPF6, ANT-1, C20orf14, Prp6, TOM, U5-102K, hPrp6; PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae); K12855 pre-mRNA-processing factor 6 Length=941 Score = 46.6 bits (109), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 20/48 (41%), Positives = 32/48 (66%), Gaps = 0/48 (0%) Query 4 TAQAIIRAAIKEGVENINAKRVWSEDAEECLSRGSITVARALYTHALE 51 T QA++RA I G+E + K W EDA+ C++ ++ ARA+Y +AL+ Sbjct 521 TCQAVMRAVIGIGIEEEDRKHTWMEDADSCVAHNALECARAIYAYALQ 568 > bbo:BBOV_IV009720 23.m06014; u5 snRNP-associated subunit, putaitve; K12855 pre-mRNA-processing factor 6 Length=1040 Score = 38.1 bits (87), Expect = 0.007, Method: Compositional matrix adjust. Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 0/51 (0%) Query 1 FFKTAQAIIRAAIKEGVENINAKRVWSEDAEECLSRGSITVARALYTHALE 51 F +TAQAII+ + G++ K W ED E + ARA+Y ALE Sbjct 527 FVQTAQAIIKCTMNIGLDPALLKETWLEDGERMEEKKLFACARAIYRSALE 577 > cel:Y59A8B.6 hypothetical protein; K12855 pre-mRNA-processing factor 6 Length=968 Score = 34.3 bits (77), Expect = 0.10, Method: Composition-based stats. Identities = 19/48 (39%), Positives = 25/48 (52%), Gaps = 0/48 (0%) Query 4 TAQAIIRAAIKEGVENINAKRVWSEDAEECLSRGSITVARALYTHALE 51 T QAIIR I GVE+ + + W DAE + T R +Y AL+ Sbjct 547 TCQAIIRNVIGLGVEDEDKRTTWLADAENFEKEEAFTCVRTVYAIALK 594 > hsa:653889 pre-mRNA-processing factor 6-like Length=406 Score = 28.1 bits (61), Expect = 7.8, Method: Compositional matrix adjust. Identities = 10/24 (41%), Positives = 18/24 (75%), Gaps = 0/24 (0%) Query 28 EDAEECLSRGSITVARALYTHALE 51 EDA+ C++ ++ ARA+Y +AL+ Sbjct 10 EDADSCVAHNALECARAIYAYALQ 33 Lambda K H 0.319 0.128 0.362 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2026933688 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40