bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_6873_orf1 Length=98 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_112990 ATP-dependent RNA helicase, putative (EC:5.9... 116 2e-26 sce:YMR290C HAS1; ATP-dependent RNA helicase; localizes to bot... 99.0 4e-21 cpv:cgd3_3920 DEAD/DEAH box ATP-dependent RNA helicase ; K1317... 97.1 1e-20 tpv:TP04_0821 ATP-dependent RNA helicase; K13179 ATP-dependent... 94.0 1e-19 xla:414715 hypothetical protein MGC83105; K13179 ATP-dependent... 91.7 6e-19 bbo:BBOV_III009130 17.m07799; DEAD/DEAH box domain containing ... 91.7 6e-19 mmu:66942 Ddx18, 2310005B10Rik, MGC117904; DEAD (Asp-Glu-Ala-A... 90.9 9e-19 hsa:8886 DDX18, FLJ33908, MrDb; DEAD (Asp-Glu-Ala-Asp) box pol... 90.1 1e-18 dre:321127 ddx18, cb155, sb:cb155, wu:fa19d11; DEAD (Asp-Glu-A... 89.0 4e-18 cel:B0511.6 hypothetical protein; K13179 ATP-dependent RNA hel... 86.7 1e-17 ath:AT3G18600 DEAD/DEAH box helicase, putative; K13179 ATP-dep... 71.6 6e-13 pfa:PFF1500c DEAD/DEAH box ATP-dependent RNA helicase, putativ... 69.3 3e-12 ath:AT5G65900 DEAD/DEAH box helicase, putative; K13179 ATP-dep... 60.5 1e-09 xla:733252 ddx10; DEAD (Asp-Glu-Ala-Asp) box polypeptide 10; K... 36.6 0.021 hsa:1662 DDX10, HRH-J8; DEAD (Asp-Glu-Ala-Asp) box polypeptide... 33.9 0.13 mmu:77591 Ddx10, 4632415A01Rik, AI646054, MGC91294; DEAD (Asp-... 33.5 0.16 hsa:84859 LRCH3, FLJ20994, FLJ43245, FLJ44976, MGC4126; leucin... 33.1 0.25 dre:569118 ddx10; DEAD (Asp-Glu-Ala-Asp) box polypeptide 10; K... 32.7 0.28 hsa:93 ACVR2B, ACTRIIB, ActR-IIB, MGC116908; activin A recepto... 31.6 0.65 mmu:11481 Acvr2b, ActRIIB, MGC118477; activin receptor IIB (EC... 31.6 0.65 xla:431850 hook2, MGC84592, hk2; hook homolog 2 31.6 sce:YBL088C TEL1; Protein kinase primarily involved in telomer... 31.2 0.74 mmu:70144 Lrch3, 2210409B11Rik, AW215594, Gm1742; leucine-rich... 31.2 0.77 mmu:11480 Acvr2a, ActrIIa, Acvr2, TactrII; activin receptor II... 30.4 1.5 hsa:92 ACVR2A, ACTRII, ACVR2; activin A receptor, type IIA (EC... 30.4 1.5 dre:553359 acvr2a, actr2a, acvr2, wu:fa02e10; activin receptor... 30.0 1.7 xla:397859 xstk2, MGC80923; activin receptor (EC:2.7.11.30); K... 30.0 1.9 ath:AT1G55550 ATP binding / microtubule motor 29.6 2.4 xla:399277 acvr2b, actriib; activin A receptor, type IIB (EC:2... 29.6 2.5 mmu:13033 Ctsd, CD, CatD; cathepsin D (EC:3.4.23.5); K01379 ca... 28.5 6.1 ath:AT5G53070 ribosomal protein L9 family protein 28.1 6.6 ath:AT2G40700 DEAD/DEAH box helicase, putative (RH17); K14806 ... 28.1 6.7 > tgo:TGME49_112990 ATP-dependent RNA helicase, putative (EC:5.99.1.3); K13179 ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13] Length=569 Score = 116 bits (291), Expect = 2e-26, Method: Composition-based stats. Identities = 50/60 (83%), Positives = 59/60 (98%), Gaps = 0/60 (0%) Query 3 FLMPEELGFLRYLKKAGVPLNEYSFPASKLANVQTQLERLIEKNYYLHKSSRDAYRSYLH 62 FLM EE+GFLRYLK+AGVPLNEY+FP++K+ANVQ+QLERLIEKNYYLHK+S+DAYRSYLH Sbjct 432 FLMAEEIGFLRYLKQAGVPLNEYTFPSNKIANVQSQLERLIEKNYYLHKASQDAYRSYLH 491 > sce:YMR290C HAS1; ATP-dependent RNA helicase; localizes to both the nuclear periphery and nucleolus; highly enriched in nuclear pore complex fractions; constituent of 66S pre-ribosomal particles (EC:3.6.1.-); K13179 ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13] Length=505 Score = 99.0 bits (245), Expect = 4e-21, Method: Composition-based stats. Identities = 41/60 (68%), Positives = 51/60 (85%), Gaps = 0/60 (0%) Query 3 FLMPEELGFLRYLKKAGVPLNEYSFPASKLANVQTQLERLIEKNYYLHKSSRDAYRSYLH 62 FL P ELGFLRYLK + VPLNEY FP +K+ANVQ+QLE+LI+ NYYLH++++D YRSYL Sbjct 393 FLTPNELGFLRYLKASKVPLNEYEFPENKIANVQSQLEKLIKSNYYLHQTAKDGYRSYLQ 452 > cpv:cgd3_3920 DEAD/DEAH box ATP-dependent RNA helicase ; K13179 ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13] Length=519 Score = 97.1 bits (240), Expect = 1e-20, Method: Compositional matrix adjust. Identities = 43/60 (71%), Positives = 52/60 (86%), Gaps = 0/60 (0%) Query 3 FLMPEELGFLRYLKKAGVPLNEYSFPASKLANVQTQLERLIEKNYYLHKSSRDAYRSYLH 62 FL+PEE+ FL+YLKK +PLNEY F +K+ANVQ QLERLIEKNY+LH S+RDAYR+YLH Sbjct 375 FLLPEEIAFLQYLKKMNIPLNEYVFGKNKVANVQNQLERLIEKNYHLHCSARDAYRAYLH 434 > tpv:TP04_0821 ATP-dependent RNA helicase; K13179 ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13] Length=529 Score = 94.0 bits (232), Expect = 1e-19, Method: Composition-based stats. Identities = 47/86 (54%), Positives = 58/86 (67%), Gaps = 13/86 (15%) Query 3 FLMPEELGFLRYLKKAGVPLNEYSFPASKLANVQTQLERLIEKNYYLHKSSRDAYRSYLH 62 FLMPEELGFL YLK V +N+Y F +K+ANVQ QLE+LIEKN++L++SS+DAYRSYLH Sbjct 404 FLMPEELGFLHYLKSLNVTINKYEFNLNKIANVQVQLEKLIEKNFHLNRSSKDAYRSYLH 463 Query 63 V-------------SPGLARVCEGFG 75 S L RV + FG Sbjct 464 AYMSHSLKDIFNVHSLDLKRVAKAFG 489 > xla:414715 hypothetical protein MGC83105; K13179 ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13] Length=638 Score = 91.7 bits (226), Expect = 6e-19, Method: Composition-based stats. Identities = 38/58 (65%), Positives = 53/58 (91%), Gaps = 0/58 (0%) Query 4 LMPEELGFLRYLKKAGVPLNEYSFPASKLANVQTQLERLIEKNYYLHKSSRDAYRSYL 61 L PEELGFLRYLK+A VPL+E+ F SK++++QTQ+E+LIEKNYYLHKS+++AY++Y+ Sbjct 496 LRPEELGFLRYLKQAKVPLSEFEFSWSKISDIQTQVEKLIEKNYYLHKSAQEAYKAYI 553 > bbo:BBOV_III009130 17.m07799; DEAD/DEAH box domain containing protein; K13179 ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13] Length=509 Score = 91.7 bits (226), Expect = 6e-19, Method: Composition-based stats. Identities = 45/86 (52%), Positives = 58/86 (67%), Gaps = 13/86 (15%) Query 3 FLMPEELGFLRYLKKAGVPLNEYSFPASKLANVQTQLERLIEKNYYLHKSSRDAYRSYLH 62 FLMPEELGFL YLK+ VPL++Y F +K+A VQ QLE+L+EKN+YL+++SR+AYRSYL Sbjct 390 FLMPEELGFLHYLKELKVPLSKYEFELNKIAKVQVQLEKLVEKNFYLNRASREAYRSYLQ 449 Query 63 V-------------SPGLARVCEGFG 75 S L RV + FG Sbjct 450 AYLSHSLKDIFNVHSLDLIRVAKSFG 475 > mmu:66942 Ddx18, 2310005B10Rik, MGC117904; DEAD (Asp-Glu-Ala-Asp) box polypeptide 18 (EC:3.6.4.13); K13179 ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13] Length=660 Score = 90.9 bits (224), Expect = 9e-19, Method: Composition-based stats. Identities = 37/58 (63%), Positives = 53/58 (91%), Gaps = 0/58 (0%) Query 4 LMPEELGFLRYLKKAGVPLNEYSFPASKLANVQTQLERLIEKNYYLHKSSRDAYRSYL 61 L PEELGFLRYLK++ VPLN++ F SK++++Q+QLE+LIEKNY+LHKS+++AY+SY+ Sbjct 520 LRPEELGFLRYLKQSKVPLNQFDFSWSKVSDIQSQLEKLIEKNYFLHKSAQEAYKSYI 577 > hsa:8886 DDX18, FLJ33908, MrDb; DEAD (Asp-Glu-Ala-Asp) box polypeptide 18 (EC:3.6.4.13); K13179 ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13] Length=670 Score = 90.1 bits (222), Expect = 1e-18, Method: Composition-based stats. Identities = 37/58 (63%), Positives = 53/58 (91%), Gaps = 0/58 (0%) Query 4 LMPEELGFLRYLKKAGVPLNEYSFPASKLANVQTQLERLIEKNYYLHKSSRDAYRSYL 61 L PEELGFLRYLK++ VPL+E+ F SK++++Q+QLE+LIEKNY+LHKS+++AY+SY+ Sbjct 530 LRPEELGFLRYLKQSKVPLSEFDFSWSKISDIQSQLEKLIEKNYFLHKSAQEAYKSYI 587 > dre:321127 ddx18, cb155, sb:cb155, wu:fa19d11; DEAD (Asp-Glu-Ala-Asp) box polypeptide 18 (EC:3.6.4.13); K13179 ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13] Length=653 Score = 89.0 bits (219), Expect = 4e-18, Method: Composition-based stats. Identities = 36/58 (62%), Positives = 53/58 (91%), Gaps = 0/58 (0%) Query 4 LMPEELGFLRYLKKAGVPLNEYSFPASKLANVQTQLERLIEKNYYLHKSSRDAYRSYL 61 L PEELGFLR+LK+A VPL+E+ F +K++++Q+QL++LIEKNYYLHKS+++AY+SY+ Sbjct 512 LRPEELGFLRFLKQAKVPLSEFEFSWTKISDIQSQLDKLIEKNYYLHKSAQEAYKSYV 569 > cel:B0511.6 hypothetical protein; K13179 ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13] Length=544 Score = 86.7 bits (213), Expect = 1e-17, Method: Composition-based stats. Identities = 39/58 (67%), Positives = 48/58 (82%), Gaps = 0/58 (0%) Query 4 LMPEELGFLRYLKKAGVPLNEYSFPASKLANVQTQLERLIEKNYYLHKSSRDAYRSYL 61 L PEELGFLRYLK A V LNE+ F SK+AN+Q+QLE LI KNYYL+KS+++AY+ YL Sbjct 419 LRPEELGFLRYLKAAKVTLNEFEFSWSKVANIQSQLENLISKNYYLNKSAKEAYKCYL 476 > ath:AT3G18600 DEAD/DEAH box helicase, putative; K13179 ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13] Length=568 Score = 71.6 bits (174), Expect = 6e-13, Method: Composition-based stats. Identities = 31/58 (53%), Positives = 44/58 (75%), Gaps = 0/58 (0%) Query 4 LMPEELGFLRYLKKAGVPLNEYSFPASKLANVQTQLERLIEKNYYLHKSSRDAYRSYL 61 L+PEEL F+RYLK A VP+ E F +L+NVQ+ LE+ + K+Y L+K ++DAYR+YL Sbjct 439 LIPEELQFIRYLKAAKVPVKELEFNEKRLSNVQSALEKCVAKDYNLNKLAKDAYRAYL 496 > pfa:PFF1500c DEAD/DEAH box ATP-dependent RNA helicase, putative; K13179 ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13] Length=601 Score = 69.3 bits (168), Expect = 3e-12, Method: Composition-based stats. Identities = 26/60 (43%), Positives = 46/60 (76%), Gaps = 0/60 (0%) Query 3 FLMPEELGFLRYLKKAGVPLNEYSFPASKLANVQTQLERLIEKNYYLHKSSRDAYRSYLH 62 FLM EL FL YLK +P+N++++ +KL N+Q+ ++ ++ KN++LHK +R+A++SYL+ Sbjct 495 FLMKHELKFLNYLKFYNIPINQFAYDPNKLINIQSHIQSIVTKNFHLHKMAREAFKSYLN 554 > ath:AT5G65900 DEAD/DEAH box helicase, putative; K13179 ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13] Length=633 Score = 60.5 bits (145), Expect = 1e-09, Method: Composition-based stats. Identities = 25/58 (43%), Positives = 42/58 (72%), Gaps = 0/58 (0%) Query 4 LMPEELGFLRYLKKAGVPLNEYSFPASKLANVQTQLERLIEKNYYLHKSSRDAYRSYL 61 L P+EL F++YLK A +P+ E+ F KL +V+ +E LI +NY L +S+++AY++Y+ Sbjct 505 LTPQELKFIQYLKAAKIPVEEHEFEEKKLLDVKPFVENLISENYALKESAKEAYKTYI 562 > xla:733252 ddx10; DEAD (Asp-Glu-Ala-Asp) box polypeptide 10; K14776 ATP-dependent RNA helicase DDX10/DBP4 [EC:3.6.4.13] Length=663 Score = 36.6 bits (83), Expect = 0.021, Method: Composition-based stats. Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Query 4 LMPEEL-GFLRYLKKAGVPLNEYSFPASKLANVQTQLERLIEKNYYLHKSSRDAYRSYL 61 L+P E+ G + L++ VP+NE KL +VQ +LE + + L ++++ + SYL Sbjct 424 LLPSEVKGMAKQLEEKKVPINEIKINPEKLLDVQGRLEAFLAQEQDLKETAQRCFVSYL 482 > hsa:1662 DDX10, HRH-J8; DEAD (Asp-Glu-Ala-Asp) box polypeptide 10 (EC:3.6.4.13); K14776 ATP-dependent RNA helicase DDX10/DBP4 [EC:3.6.4.13] Length=875 Score = 33.9 bits (76), Expect = 0.13, Method: Composition-based stats. Identities = 16/58 (27%), Positives = 32/58 (55%), Gaps = 0/58 (0%) Query 4 LMPEELGFLRYLKKAGVPLNEYSFPASKLANVQTQLERLIEKNYYLHKSSRDAYRSYL 61 L+P E ++ L + VP+ E KL +VQ +LE ++ ++ L + ++ + SY+ Sbjct 419 LLPSEKAMVQQLLQKKVPVKEIKINPEKLIDVQKKLESILAQDQDLKERAQRCFVSYV 476 > mmu:77591 Ddx10, 4632415A01Rik, AI646054, MGC91294; DEAD (Asp-Glu-Ala-Asp) box polypeptide 10 (EC:3.6.4.13); K14776 ATP-dependent RNA helicase DDX10/DBP4 [EC:3.6.4.13] Length=875 Score = 33.5 bits (75), Expect = 0.16, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Query 4 LMP-EELGFLRYLKKAGVPLNEYSFPASKLANVQTQLERLIEKNYYLHKSSRDAYRSYL 61 L+P EE G ++ L + VP+ E KL +VQ +LE + ++ L + ++ + SY+ Sbjct 419 LLPSEEQGMVQQLLQKKVPVKEIKINPEKLIDVQKKLESFLAQDQDLKERAQRCFVSYI 477 > hsa:84859 LRCH3, FLJ20994, FLJ43245, FLJ44976, MGC4126; leucine-rich repeats and calponin homology (CH) domain containing 3 Length=712 Score = 33.1 bits (74), Expect = 0.25, Method: Composition-based stats. Identities = 14/46 (30%), Positives = 27/46 (58%), Gaps = 0/46 (0%) Query 5 MPEELGFLRYLKKAGVPLNEYSFPASKLANVQTQLERLIEKNYYLH 50 +PEE+G LR+L + V NE S++ N++ + + +N+ +H Sbjct 165 LPEEIGHLRHLMELDVSCNEIQTIPSQIGNLEALRDLNVRRNHLVH 210 > dre:569118 ddx10; DEAD (Asp-Glu-Ala-Asp) box polypeptide 10; K14776 ATP-dependent RNA helicase DDX10/DBP4 [EC:3.6.4.13] Length=864 Score = 32.7 bits (73), Expect = 0.28, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Query 4 LMP-EELGFLRYLKKAGVPLNEYSFPASKLANVQTQLERLIEKNYYLHKSSRDAYRSYL 61 L+P EE G + L++ VP+N+ KL +VQ +LE + + + ++ + SYL Sbjct 420 LLPSEEKGMISQLQEKKVPINKIQVNPEKLMSVQQKLEAFLAQEKEQKERAQRCFVSYL 478 > hsa:93 ACVR2B, ACTRIIB, ActR-IIB, MGC116908; activin A receptor, type IIB (EC:2.7.11.30); K13596 activin receptor type-2B [EC:2.7.11.30] Length=512 Score = 31.6 bits (70), Expect = 0.65, Method: Compositional matrix adjust. Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 2/56 (3%) Query 16 KKAGVPLNEYSFPASKLANVQTQLERLIEKNYYLHKSSRDAYRSYLHVSPGLARVC 71 K A P++EY P + LE L E +HK R + + PGLA++C Sbjct 401 KAADGPVDEYMLPFEEEIGQHPSLEELQE--VVVHKKMRPTIKDHWLKHPGLAQLC 454 > mmu:11481 Acvr2b, ActRIIB, MGC118477; activin receptor IIB (EC:2.7.11.30); K13596 activin receptor type-2B [EC:2.7.11.30] Length=536 Score = 31.6 bits (70), Expect = 0.65, Method: Compositional matrix adjust. Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 2/56 (3%) Query 16 KKAGVPLNEYSFPASKLANVQTQLERLIEKNYYLHKSSRDAYRSYLHVSPGLARVC 71 K A P++EY P + LE L E +HK R + + PGLA++C Sbjct 425 KAADGPVDEYMLPFEEEIGQHPSLEELQE--VVVHKKMRPTIKDHWLKHPGLAQLC 478 > xla:431850 hook2, MGC84592, hk2; hook homolog 2 Length=721 Score = 31.6 bits (70), Expect = 0.69, Method: Composition-based stats. Identities = 16/28 (57%), Positives = 22/28 (78%), Gaps = 1/28 (3%) Query 31 KLANVQTQLERLIEKNYYLHKSSRDAYR 58 KL +Q+Q+E+L E+NY L +SSRD YR Sbjct 237 KLLLLQSQIEQLQEENYRL-ESSRDDYR 263 > sce:YBL088C TEL1; Protein kinase primarily involved in telomere length regulation; contributes to cell cycle checkpoint control in response to DNA damage; functionally redundant with Mec1p; homolog of human ataxia telangiectasia (ATM) gene (EC:2.7.11.1); K04728 ataxia telangectasia mutated family protein [EC:2.7.11.1] Length=2787 Score = 31.2 bits (69), Expect = 0.74, Method: Composition-based stats. Identities = 13/52 (25%), Positives = 31/52 (59%), Gaps = 0/52 (0%) Query 12 LRYLKKAGVPLNEYSFPASKLANVQTQLERLIEKNYYLHKSSRDAYRSYLHV 63 + ++K A +P + SFP + ++ ++ ERL ++Y HK++ + + ++V Sbjct 1927 IEFIKIAAIPQDVTSFPQTLMSIMKADKERLNTIDFYDHKTTLKSRHTLMNV 1978 > mmu:70144 Lrch3, 2210409B11Rik, AW215594, Gm1742; leucine-rich repeats and calponin homology (CH) domain containing 3 Length=778 Score = 31.2 bits (69), Expect = 0.77, Method: Composition-based stats. Identities = 14/45 (31%), Positives = 26/45 (57%), Gaps = 0/45 (0%) Query 5 MPEELGFLRYLKKAGVPLNEYSFPASKLANVQTQLERLIEKNYYL 49 +PEE+G LR+L + V NE S++ N++ + + +N+ L Sbjct 165 LPEEIGHLRHLTELDVSCNEIQTVPSQIGNLEALRDFNVRRNHLL 209 > mmu:11480 Acvr2a, ActrIIa, Acvr2, TactrII; activin receptor IIA (EC:2.7.11.30); K04670 activin receptor type-2A [EC:2.7.11.30] Length=513 Score = 30.4 bits (67), Expect = 1.5, Method: Composition-based stats. Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 2/52 (3%) Query 21 PLNEYSFPASKLANVQTQLERLIEKNYYLHKSSRDAYRSYLHVSPGLARVCE 72 P++EY P + LE + E +HK R R Y G+A +CE Sbjct 407 PVDEYMLPFEEEIGQHPSLEDMQE--VVVHKKKRPVLRDYWQKHAGMAMLCE 456 > hsa:92 ACVR2A, ACTRII, ACVR2; activin A receptor, type IIA (EC:2.7.11.30); K04670 activin receptor type-2A [EC:2.7.11.30] Length=513 Score = 30.4 bits (67), Expect = 1.5, Method: Composition-based stats. Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 2/52 (3%) Query 21 PLNEYSFPASKLANVQTQLERLIEKNYYLHKSSRDAYRSYLHVSPGLARVCE 72 P++EY P + LE + E +HK R R Y G+A +CE Sbjct 407 PVDEYMLPFEEEIGQHPSLEDMQE--VVVHKKKRPVLRDYWQKHAGMAMLCE 456 > dre:553359 acvr2a, actr2a, acvr2, wu:fa02e10; activin receptor IIa (EC:2.7.11.30); K04670 activin receptor type-2A [EC:2.7.11.30] Length=514 Score = 30.0 bits (66), Expect = 1.7, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 23/52 (44%), Gaps = 2/52 (3%) Query 21 PLNEYSFPASKLANVQTQLERLIEKNYYLHKSSRDAYRSYLHVSPGLARVCE 72 P++EY P + LE + E +HK R R PGLA +CE Sbjct 408 PVDEYMLPFEEEVGQHPTLEDMQE--VVVHKKLRPTLRECWQKHPGLAMLCE 457 > xla:397859 xstk2, MGC80923; activin receptor (EC:2.7.11.30); K13596 activin receptor type-2B [EC:2.7.11.30] Length=510 Score = 30.0 bits (66), Expect = 1.9, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Query 21 PLNEYSFPASKLANVQTQLERLIEKNYYLHKSSRDAYRSYLHVSPGLARVC 71 P++EY P + LE L E +HK R ++ + PGLA++C Sbjct 404 PVDEYLLPFEEEIGQHPSLEDLQE--VVVHKKMRPVFKDHWLKHPGLAQLC 452 > ath:AT1G55550 ATP binding / microtubule motor Length=859 Score = 29.6 bits (65), Expect = 2.4, Method: Composition-based stats. Identities = 13/46 (28%), Positives = 22/46 (47%), Gaps = 0/46 (0%) Query 24 EYSFPASKLANVQTQLERLIEKNYYLHKSSRDAYRSYLHVSPGLAR 69 E K+ N+ LE+L K + + + +D R +HV+P R Sbjct 442 EREMSLRKMRNLNETLEKLTGKPHVIEEEEKDVVREVIHVTPKKPR 487 > xla:399277 acvr2b, actriib; activin A receptor, type IIB (EC:2.7.11.30) Length=511 Score = 29.6 bits (65), Expect = 2.5, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Query 21 PLNEYSFPASKLANVQTQLERLIEKNYYLHKSSRDAYRSYLHVSPGLARVC 71 P++EY P + LE L E +HK R ++ + PGLA++C Sbjct 405 PVDEYLLPFEEEIGQHPSLEDLQE--VVVHKKIRPVFKDHWLKHPGLAQLC 453 > mmu:13033 Ctsd, CD, CatD; cathepsin D (EC:3.4.23.5); K01379 cathepsin D [EC:3.4.23.5] Length=410 Score = 28.5 bits (62), Expect = 6.1, Method: Composition-based stats. Identities = 26/68 (38%), Positives = 35/68 (51%), Gaps = 10/68 (14%) Query 12 LRYLKKA--GVPL--NEYSFPASKLANVQTQLERLIEKNYYLHKSSRDAYRSYLHVSPGL 67 ++ L+KA VPL EY P K++++ T +L KNY LH D Y L VS G Sbjct 306 VKELQKAIGAVPLIQGEYMIPCEKVSSLPTVYLKLGGKNYELHP---DKY--ILKVSQGG 360 Query 68 ARVC-EGF 74 +C GF Sbjct 361 KTICLSGF 368 > ath:AT5G53070 ribosomal protein L9 family protein Length=221 Score = 28.1 bits (61), Expect = 6.6, Method: Compositional matrix adjust. Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 0/36 (0%) Query 20 VPLNEYSFPASKLANVQTQLERLIEKNYYLHKSSRD 55 V EY A +LAN L +L++K + ++SS+D Sbjct 115 VQTKEYEKAAKRLANANLVLRKLVDKEKFKNRSSKD 150 > ath:AT2G40700 DEAD/DEAH box helicase, putative (RH17); K14806 ATP-dependent RNA helicase DDX31/DBP7 [EC:3.6.4.13] Length=609 Score = 28.1 bits (61), Expect = 6.7, Method: Composition-based stats. Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 0/23 (0%) Query 3 FLMPEELGFLRYLKKAGVPLNEY 25 FL P E+ +L+ LKK G L EY Sbjct 452 FLQPIEIDYLKELKKHGASLTEY 474 Lambda K H 0.321 0.141 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2050913756 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40