bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_6975_orf1 Length=104 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_011410 hypothetical protein ; K15027 translation in... 95.5 3e-20 ath:AT1G71350 eukaryotic translation initiation factor SUI1 fa... 50.4 1e-06 pfa:PFI0365w translation initiation factor SUI1, putative; K15... 48.9 4e-06 bbo:BBOV_II005360 18.m10002; hypothetical protein 41.2 8e-04 cpv:cgd4_70 hypothetical protein 35.8 0.036 ath:AT1G23150 hypothetical protein 32.0 0.51 sce:YDR117C TMA64; Protein of unknown function that associates... 30.4 1.5 xla:414447 lepre1, MGC84556; leucine proline-enriched proteogl... 30.4 1.5 dre:573360 xpnpep3, MGC76905, zgc:76905; X-prolyl aminopeptida... 28.9 3.7 xla:443988 ppm1d, MGC80458; protein phosphatase, Mg2+/Mn2+ dep... 28.5 4.7 hsa:4130 MAP1A, FLJ77111, MAP1L, MTAP1A; microtubule-associate... 28.1 6.3 > tgo:TGME49_011410 hypothetical protein ; K15027 translation initiation factor 2D Length=748 Score = 95.5 bits (236), Expect = 3e-20, Method: Compositional matrix adjust. Identities = 48/105 (45%), Positives = 65/105 (61%), Gaps = 2/105 (1%) Query 1 DEEAKAAGPEKLVMDKGEIFVRWMDTAQPCHAVLRDEG--ELPLLQGRIVRGACNPVRIS 58 DE A + G E+ M K E+F RW QPCH ++ L + ++ +G C PV+IS Sbjct 598 DELATSKGSEEFSMKKEEVFSRWQAALQPCHVIVPAGAPKNLDVSTLKVHKGTCPPVKIS 657 Query 59 VEEKQGGRKHVTHIANVTNFLVEPKAVAKLLRKKLGAWASVYAPP 103 VE++ GGRKH+TH+ V FL++PK VA L+KKL A AS YA P Sbjct 658 VEDRFGGRKHITHVVGVHVFLLDPKTVADYLQKKLAAAASTYALP 702 > ath:AT1G71350 eukaryotic translation initiation factor SUI1 family protein; K15027 translation initiation factor 2D Length=597 Score = 50.4 bits (119), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 32/85 (37%), Positives = 46/85 (54%), Gaps = 9/85 (10%) Query 15 DKGEIFVRWMDTAQPCHAVLRDEGELPLLQGRIVRGACNPVRISVEEKQGGRKHVTHIAN 74 D G FV M QP H V+R GE P+++ +GA PV+I E +QG +K VT + Sbjct 478 DVGSTFVGRM---QPNHVVMRGGGE-PVVR----KGAVKPVQIMTERRQGNKK-VTKVTG 528 Query 75 VTNFLVEPKAVAKLLRKKLGAWASV 99 + FL++P + L+KK SV Sbjct 529 METFLIDPDSFGSELQKKFACSTSV 553 > pfa:PFI0365w translation initiation factor SUI1, putative; K15027 translation initiation factor 2D Length=818 Score = 48.9 bits (115), Expect = 4e-06, Method: Composition-based stats. Identities = 23/86 (26%), Positives = 45/86 (52%), Gaps = 0/86 (0%) Query 19 IFVRWMDTAQPCHAVLRDEGELPLLQGRIVRGACNPVRISVEEKQGGRKHVTHIANVTNF 78 I +++ QPC+A+++ + +I +G C + I + G+K+VTHI N+ F Sbjct 696 IMNQFISLQQPCYAIIKPNANFDIEPIKITKGVCPSIHIYSVARMKGKKYVTHITNLYLF 755 Query 79 LVEPKAVAKLLRKKLGAWASVYAPPN 104 V+ ++ L+K+L S+ P+ Sbjct 756 HVDLNKFSEHLQKQLACSCSIVISPS 781 > bbo:BBOV_II005360 18.m10002; hypothetical protein Length=465 Score = 41.2 bits (95), Expect = 8e-04, Method: Composition-based stats. Identities = 28/89 (31%), Positives = 47/89 (52%), Gaps = 8/89 (8%) Query 13 VMDKGEIFVRWMDTAQPCHAVLRDEGELPLLQGRIVRGACNPVRISVEEKQGGRKHVTHI 72 V +G + ++ ++ A H + E E P I +GA PV + VE + G RKHVT + Sbjct 349 VSSEGPVILQHVNDAVQYHQITHGENESP-----IKKGAALPVSVLVEPR-GNRKHVTTV 402 Query 73 ANVTNFL--VEPKAVAKLLRKKLGAWASV 99 + +L ++ VA++LR+K + SV Sbjct 403 KGLFTYLFDLDESQVAEILRRKFASSVSV 431 > cpv:cgd4_70 hypothetical protein Length=718 Score = 35.8 bits (81), Expect = 0.036, Method: Composition-based stats. Identities = 20/54 (37%), Positives = 32/54 (59%), Gaps = 1/54 (1%) Query 47 IVRGACNPVRISVEEKQGGRKHVTHIAN-VTNFLVEPKAVAKLLRKKLGAWASV 99 I +G C + I E + G RKHVT I+ +++F ++ + VA+ +KK ASV Sbjct 623 IHKGPCKIIEIYTESRMGTRKHVTIISPFISHFNLDLQEVAESCQKKFACSASV 676 > ath:AT1G23150 hypothetical protein Length=141 Score = 32.0 bits (71), Expect = 0.51, Method: Compositional matrix adjust. Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 3/38 (7%) Query 6 AAGPEKLVMDKGEIFVRWMDTAQPCHAVLRDEGELPLL 43 +AGP + V ++G++ +DTA C+A EG LP+L Sbjct 25 SAGPIRFVANEGDLVASVIDTALKCYA---REGRLPIL 59 > sce:YDR117C TMA64; Protein of unknown function that associates with ribosomes; has a putative RNA binding domain; K15027 translation initiation factor 2D Length=565 Score = 30.4 bits (67), Expect = 1.5, Method: Composition-based stats. Identities = 15/44 (34%), Positives = 29/44 (65%), Gaps = 1/44 (2%) Query 48 VRGACNPVRISVEEKQGGRKHVTHIANVTNFLVEPKAVAKLLRK 91 ++G+ ++I + E + GRK +T ++N F V+P+++A LRK Sbjct 468 MKGSLPHIKI-ITEMKIGRKVITRVSNFEVFQVDPESLAADLRK 510 > xla:414447 lepre1, MGC84556; leucine proline-enriched proteoglycan (leprecan) 1; K08134 leucine proline-enriched proteoglycan (leprecan) Length=765 Score = 30.4 bits (67), Expect = 1.5, Method: Composition-based stats. Identities = 13/29 (44%), Positives = 20/29 (68%), Gaps = 0/29 (0%) Query 56 RISVEEKQGGRKHVTHIANVTNFLVEPKA 84 R +VEEKQ GRK ++H +V N ++ +A Sbjct 558 RTAVEEKQDGRKDLSHPVHVDNCILNAEA 586 > dre:573360 xpnpep3, MGC76905, zgc:76905; X-prolyl aminopeptidase (aminopeptidase P) 3, putative (EC:3.4.11.9); K01262 Xaa-Pro aminopeptidase [EC:3.4.11.9] Length=510 Score = 28.9 bits (63), Expect = 3.7, Method: Composition-based stats. Identities = 11/23 (47%), Positives = 13/23 (56%), Gaps = 0/23 (0%) Query 23 WMDTAQPCHAVLRDEGELPLLQG 45 W D +QPCH L PLL+G Sbjct 207 WYDNSQPCHQRLHQTHVRPLLEG 229 > xla:443988 ppm1d, MGC80458; protein phosphatase, Mg2+/Mn2+ dependent, 1D (EC:3.1.3.16); K10147 protein phosphatase 1D (formerly 2C) [EC:3.1.3.16] Length=554 Score = 28.5 bits (62), Expect = 4.7, Method: Composition-based stats. Identities = 14/29 (48%), Positives = 20/29 (68%), Gaps = 3/29 (10%) Query 55 VRISVEEKQGGRKHVTHIANVTNFLVEPK 83 +R+SV QGGRK ++ +VT LVEP+ Sbjct 7 LRVSVSSDQGGRK---YMEDVTQILVEPE 32 > hsa:4130 MAP1A, FLJ77111, MAP1L, MTAP1A; microtubule-associated protein 1A; K10429 microtubule-associated protein 1 Length=2803 Score = 28.1 bits (61), Expect = 6.3, Method: Compositional matrix adjust. Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Query 27 AQPCHAVLRDEGELPLLQGRIVRGACNPVRISVEEKQGGRKH 68 A P A + +G P L G I+ +C+P R S K+ GR H Sbjct 2061 AVPPRAPILSKGPSPPLNGNIL--SCSPDRRSPSPKESGRSH 2100 Lambda K H 0.318 0.135 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2022291452 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40