bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_7383_orf4 Length=127 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_082230 sulfate adenylyltransferas-adenylylsulfate k... 89.7 2e-18 sce:YJR010W MET3; ATP sulfurylase, catalyzes the primary step ... 40.8 0.001 mmu:338351 Akap17b, AA407619, AKAP-17B, B230333C21Rik, C230056... 33.1 0.20 hsa:81704 DOCK8, FLJ00026, FLJ00152, FLJ00346, MRD2, ZIR8; ded... 30.0 1.7 sce:YKL210W UBA1; Uba1p; K03178 ubiquitin-activating enzyme E1... 29.3 2.8 mmu:78252 Fam55b, 4432416J03Rik, AI323362; family with sequenc... 28.9 4.3 tgo:TGME49_115940 rhoptry protein, putative 28.1 6.5 > tgo:TGME49_082230 sulfate adenylyltransferas-adenylylsulfate kinase, putative (EC:2.7.7.4 2.7.1.25); K00958 sulfate adenylyltransferase [EC:2.7.7.4] Length=607 Score = 89.7 bits (221), Expect = 2e-18, Method: Composition-based stats. Identities = 37/58 (63%), Positives = 46/58 (79%), Gaps = 0/58 (0%) Query 1 GTEFRRRLTARLPIPEWFSFPKVIEELQQFYKQNHERGLCVYFTGLPCSGAAPLHAAF 58 GT+FRR L R PIP WFSFP+V +EL++FYK N++RGLC+YFTGLPCSG + L A Sbjct 387 GTQFRRLLEERQPIPTWFSFPEVADELRKFYKPNYQRGLCIYFTGLPCSGKSTLAQAL 444 > sce:YJR010W MET3; ATP sulfurylase, catalyzes the primary step of intracellular sulfate activation, essential for assimilatory reduction of sulfate to sulfide, involved in methionine metabolism (EC:2.7.7.4); K00958 sulfate adenylyltransferase [EC:2.7.7.4] Length=511 Score = 40.8 bits (94), Expect = 0.001, Method: Composition-based stats. Identities = 17/41 (41%), Positives = 26/41 (63%), Gaps = 0/41 (0%) Query 1 GTEFRRRLTARLPIPEWFSFPKVIEELQQFYKQNHERGLCV 41 GTE RRRL IPEWFS+P+V++ L++ ++G + Sbjct 358 GTELRRRLRVGGEIPEWFSYPEVVKILRESNPPRPKQGFSI 398 > mmu:338351 Akap17b, AA407619, AKAP-17B, B230333C21Rik, C230056F04Rik, PRKA17B, Sfrs17b, Srsf17b, Talia; A kinase (PRKA) anchor protein 17B; K13169 splicing factor, arginine/serine-rich 17 Length=959 Score = 33.1 bits (74), Expect = 0.20, Method: Composition-based stats. Identities = 19/44 (43%), Positives = 25/44 (56%), Gaps = 9/44 (20%) Query 16 EWFSFPK-----VIEELQQFYKQNHERGL-CVYFTGLPCSGAAP 53 EW FPK VIE ++ Q+H++G +YF GLPC AP Sbjct 119 EWEHFPKEKEASVIEGAEE---QDHDKGPDSIYFEGLPCKWFAP 159 > hsa:81704 DOCK8, FLJ00026, FLJ00152, FLJ00346, MRD2, ZIR8; dedicator of cytokinesis 8 Length=1999 Score = 30.0 bits (66), Expect = 1.7, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Query 58 FRFLNKLQRSSKLLLRRYRAAALLLRRSGAAAQELLRCC 96 F+FL +RSS L RR ++ LLR + A E++ CC Sbjct 417 FKFLADYKRSSSLQ-RRVKSIPGLLRLEISTAPEIINCC 454 > sce:YKL210W UBA1; Uba1p; K03178 ubiquitin-activating enzyme E1 [EC:6.3.2.19] Length=1024 Score = 29.3 bits (64), Expect = 2.8, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 18/33 (54%), Gaps = 0/33 (0%) Query 86 GAAAQELLRCCCGRLSPAQGFLNSICMRVQPSP 118 G AQE+L+ C G+ +P + F+ + P P Sbjct 368 GLVAQEVLKACSGKFTPLKQFMYFDSLESLPDP 400 > mmu:78252 Fam55b, 4432416J03Rik, AI323362; family with sequence similarity 55, member B Length=558 Score = 28.9 bits (63), Expect = 4.3, Method: Composition-based stats. Identities = 14/51 (27%), Positives = 23/51 (45%), Gaps = 0/51 (0%) Query 25 EELQQFYKQNHERGLCVYFTGLPCSGAAPLHAAFRFLNKLQRSSKLLLRRY 75 E Q ++HE C+ G+PC + + ++ L KLL RR+ Sbjct 239 ELCQYLDARDHEAFYCLKLPGVPCEALTHMTSKNSNISYLSLEEKLLFRRF 289 > tgo:TGME49_115940 rhoptry protein, putative Length=999 Score = 28.1 bits (61), Expect = 6.5, Method: Compositional matrix adjust. Identities = 18/43 (41%), Positives = 21/43 (48%), Gaps = 4/43 (9%) Query 81 LLRRSGAAAQELLRCCCGRLSPAQGFLNSICMRVQPSPAASGW 123 +LR AA Q LLRCC +SP FL P+P S W Sbjct 302 MLRWPRAALQLLLRCCHSLVSPGAPFLPP----TWPTPWISVW 340 Lambda K H 0.329 0.139 0.452 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2054672932 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40