bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_7390_orf2 Length=84 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_059550 hydroxymethyldihydropterin pyrophosphokinase... 68.6 5e-12 sce:YNL256W FOL1; Fol1p (EC:4.1.2.25 2.7.6.3 2.5.1.15); K13939... 43.1 2e-04 eco:b0142 folK, ECK0141, JW0138; 2-amino-4-hydroxy-6-hydroxyme... 40.0 0.002 ath:AT4G30000 dihydropterin pyrophosphokinase, putative / dihy... 33.9 0.12 tpv:TP01_0549 hypothetical protein 29.6 2.8 hsa:57453 DSCAML1, KIAA1132; Down syndrome cell adhesion molec... 27.7 9.7 > tgo:TGME49_059550 hydroxymethyldihydropterin pyrophosphokinase-dihydropteroate synthase (EC:2.7.6.3 2.5.1.15); K00796 dihydropteroate synthase [EC:2.5.1.15]; K00950 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3] Length=748 Score = 68.6 bits (166), Expect = 5e-12, Method: Composition-based stats. Identities = 29/63 (46%), Positives = 43/63 (68%), Gaps = 0/63 (0%) Query 18 LTLPHPRLAQRNFILFPLCDIKPDLVHPTERETMKNLILKNMRRREEALRHSASSSGETS 77 LTLPHPR+ RNF+LFPLCD+ P+ +HP E ++K L+ N+ RR L ++A + +T Sbjct 273 LTLPHPRIITRNFVLFPLCDLDPEYIHPVEGMSVKELLRINLERRRIHLLNAAEEARQTQ 332 Query 78 DAA 80 + A Sbjct 333 ELA 335 > sce:YNL256W FOL1; Fol1p (EC:4.1.2.25 2.7.6.3 2.5.1.15); K13939 dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:4.1.2.25 2.7.6.3 2.5.1.15] Length=824 Score = 43.1 bits (100), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 20/47 (42%), Positives = 30/47 (63%), Gaps = 1/47 (2%) Query 4 VDSASYSMQVNTTNLTLPHPRLAQRNFILFPLCD-IKPDLVHPTERE 49 ++SA + VN +L +PHPR+ +R F+L PLC+ I P +HP E Sbjct 399 LNSAGEDIIVNEPDLNIPHPRMLERTFVLEPLCELISPVHLHPVTAE 445 > eco:b0142 folK, ECK0141, JW0138; 2-amino-4-hydroxy-6-hydroxymethyldihyropteridine pyrophosphokinase (EC:2.7.6.3); K00950 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3] Length=159 Score = 40.0 bits (92), Expect = 0.002, Method: Compositional matrix adjust. Identities = 16/33 (48%), Positives = 23/33 (69%), Gaps = 0/33 (0%) Query 13 VNTTNLTLPHPRLAQRNFILFPLCDIKPDLVHP 45 +NT LT+PH + R F+L+PL +I P+LV P Sbjct 107 INTERLTVPHYDMKNRGFMLWPLFEIAPELVFP 139 > ath:AT4G30000 dihydropterin pyrophosphokinase, putative / dihydropteroate synthase, putative / DHPS, putative; K13941 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15] Length=554 Score = 33.9 bits (76), Expect = 0.12, Method: Compositional matrix adjust. Identities = 12/28 (42%), Positives = 21/28 (75%), Gaps = 0/28 (0%) Query 11 MQVNTTNLTLPHPRLAQRNFILFPLCDI 38 M++++ L +PH RL +R+F+L PL D+ Sbjct 188 MRISSDKLIIPHERLWERSFVLAPLVDL 215 > tpv:TP01_0549 hypothetical protein Length=277 Score = 29.6 bits (65), Expect = 2.8, Method: Composition-based stats. Identities = 14/43 (32%), Positives = 26/43 (60%), Gaps = 4/43 (9%) Query 38 IKPDLVHPTERETMKNLILKNMRRREEA----LRHSASSSGET 76 +KP+L+H + + N +KN++ RE +RH+ ++SG T Sbjct 235 LKPNLIHDYTIKNIINSKVKNVKERENKSSSIVRHNTNASGNT 277 > hsa:57453 DSCAML1, KIAA1132; Down syndrome cell adhesion molecule like 1; K06768 Down syndrome cell adhesion molecule like 1 Length=2113 Score = 27.7 bits (60), Expect = 9.7, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 5/54 (9%) Query 4 VDSASYSMQVN----TTNLTLPHPRLAQRNFILFPLCDIKPDLVHPTERETMKN 53 V A +S VN T ++L HP L Q L + DI+P +P R+ +K+ Sbjct 1744 VTDAEFSQAVNPQSFCTGVSLHHPTLIQSTGPLIDMSDIRPG-TNPVSRKNVKS 1796 Lambda K H 0.317 0.128 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2040069136 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40