bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_7462_orf1 Length=122 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_070770 hypothetical protein ; K12822 RNA-binding pr... 99.8 2e-21 pfa:PFF0505c conserved Plasmodium protein, unknown function 40.0 0.002 pfa:PF13_0198 PfRh2a; reticulocyte binding protein 2 homolog A... 35.4 0.044 > tgo:TGME49_070770 hypothetical protein ; K12822 RNA-binding protein 25 Length=779 Score = 99.8 bits (247), Expect = 2e-21, Method: Compositional matrix adjust. Identities = 46/95 (48%), Positives = 67/95 (70%), Gaps = 0/95 (0%) Query 21 LRKLDPEAIAAAAENSIYRIAPDGTDRRTYIEEDYRPSRRELERLQNASRREAEYEREFT 80 L+ ++PE AA+ S+YR+ PDG DRR YI EDYRP RRELERL + RR++E+E+EF Sbjct 375 LKAMNPELAEAASSCSVYRVGPDGVDRRRYITEDYRPCRRELERLHHLERRDSEFEKEFR 434 Query 81 RREAAWKIEEQNLAVDREKELVGEMEISEEEKESL 115 RRE W E++ ++EKE+ E EI +++++ L Sbjct 435 RRELEWITREEDFKQNKEKEVALEQEIRDDDRQHL 469 > pfa:PFF0505c conserved Plasmodium protein, unknown function Length=960 Score = 40.0 bits (92), Expect = 0.002, Method: Composition-based stats. Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 0/51 (0%) Query 50 YIEEDYRPSRRELERLQNASRREAEYEREFTRREAAWKIEEQNLAVDREKE 100 YI ++Y+ + RE ERLQ +E + EREF +RE W E+ + D KE Sbjct 416 YISKEYKINWRERERLQKTEYKEKDLEREFYKREKEWIELEEQIKKDTYKE 466 > pfa:PF13_0198 PfRh2a; reticulocyte binding protein 2 homolog A; K13849 reticulocyte-binding protein Length=3130 Score = 35.4 bits (80), Expect = 0.044, Method: Composition-based stats. Identities = 19/71 (26%), Positives = 37/71 (52%), Gaps = 0/71 (0%) Query 51 IEEDYRPSRRELERLQNASRREAEYEREFTRREAAWKIEEQNLAVDREKELVGEMEISEE 110 ++++ R+E ERL+ + + + E E R+E +E+ L ++ L E E+ + Sbjct 2797 LQKEEELKRQEQERLEREKQEQLQKEEELKRQEQERLQKEEALKRQEQERLQKEEELKRQ 2856 Query 111 EKESLSRRTFE 121 E+E L R+ E Sbjct 2857 EQERLERKKIE 2867 Score = 33.5 bits (75), Expect = 0.17, Method: Composition-based stats. Identities = 19/71 (26%), Positives = 36/71 (50%), Gaps = 0/71 (0%) Query 51 IEEDYRPSRRELERLQNASRREAEYEREFTRREAAWKIEEQNLAVDREKELVGEMEISEE 110 ++++ R+E ERL+ + + + E E R+E +E+ L ++ L E E+ + Sbjct 2747 LQKEEELKRQEQERLEREKQEQLQKEEELKRQEQERLQKEEALKRQEQERLQKEEELKRQ 2806 Query 111 EKESLSRRTFE 121 E+E L R E Sbjct 2807 EQERLEREKQE 2817 Score = 31.6 bits (70), Expect = 0.58, Method: Composition-based stats. Identities = 15/72 (20%), Positives = 39/72 (54%), Gaps = 0/72 (0%) Query 46 DRRTYIEEDYRPSRRELERLQNASRREAEYEREFTRREAAWKIEEQNLAVDREKELVGEM 105 +++ ++++ R+E ERLQ + + + + E + E++ L +++++L E Sbjct 2764 EKQEQLQKEEELKRQEQERLQKEEALKRQEQERLQKEEELKRQEQERLEREKQEQLQKEE 2823 Query 106 EISEEEKESLSR 117 E+ +E+E L + Sbjct 2824 ELKRQEQERLQK 2835 Lambda K H 0.309 0.124 0.331 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2008132680 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40