bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_7506_orf2 Length=158 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_080380 non-transmembrane antigen (EC:3.2.1.143); K0... 64.3 2e-10 > tgo:TGME49_080380 non-transmembrane antigen (EC:3.2.1.143); K07759 poly(ADP-ribose) glycohydrolase [EC:3.2.1.143] Length=553 Score = 64.3 bits (155), Expect = 2e-10, Method: Composition-based stats. Identities = 39/116 (33%), Positives = 60/116 (51%), Gaps = 3/116 (2%) Query 46 AILLPQNPQGWQQVQQILAEVEAGKVPKTAGEYKQLFTSILTAAGNWRVDKPLRI---GP 102 AIL + W + + IL V +G P + L +L +GN R +K RI G Sbjct 47 AILRTPVEEDWGKTKYILNFVASGFGPADPQQLASLQKRLLKLSGNIRTEKNKRILQRGL 106 Query 103 LTHHLATHKNLSKSLLPFLASLARRLPDFFPSGIRHLGRDNPAVHLRRIEVLALLA 158 L + LPF+A+L R+ + FPSG++++ +NP VHLR+I+V L+A Sbjct 107 LNYLEENPGKFFSHDLPFMATLVMRIDELFPSGLQYITPENPQVHLRKIQVFTLIA 162 Lambda K H 0.322 0.135 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 3582056500 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40