bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_7594_orf1 Length=124 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_025470 peptide methionine sulfoxide reductase, puta... 70.9 9e-13 sce:YER042W MXR1; Methionine-S-sulfoxide reductase, involved i... 63.5 1e-10 mmu:110265 Msra, 2310045J23Rik, 6530413P12Rik, MGC101976, MSR-... 62.8 3e-10 dre:793910 si:dkey-221h15.1 (EC:1.8.4.11); K07304 peptide-meth... 61.2 8e-10 ath:AT5G61640 PMSR1; PMSR1 (PEPTIDEMETHIONINE SULFOXIDE REDUCT... 56.6 2e-08 hsa:4482 MSRA, PMSR; methionine sulfoxide reductase A (EC:1.8.... 55.1 6e-08 xla:379956 msra.1, MGC64457, msra; methionine sulfoxide reduct... 53.9 1e-07 ath:AT4G25130 peptide methionine sulfoxide reductase, putative... 52.8 2e-07 ath:AT5G07470 PMSR3; PMSR3 (PEPTIDEMETHIONINE SULFOXIDE REDUCT... 50.4 1e-06 ath:AT5G07460 PMSR2; PMSR2 (PEPTIDEMETHIONINE SULFOXIDE REDUCT... 48.9 4e-06 ath:AT2G18030 peptide methionine sulfoxide reductase family pr... 48.5 5e-06 eco:b4219 msrA, ECK4215, JW4178, pms, pmsR; methionine sulfoxi... 44.7 8e-05 ath:AT2G17110 hypothetical protein 32.3 0.41 dre:503993 im:7149628; K07304 peptide-methionine (S)-S-oxide r... 30.8 1.2 tpv:TP04_0626 mRNA cleavage factor protein; K14397 cleavage an... 29.6 2.7 cpv:cgd4_3720 hypothetical protein 29.3 2.9 dre:30470 epb4.1l4, EPB41L4, nbl4, wu:fc29f06; erythrocyte pro... 28.9 4.1 cel:F43E2.5 hypothetical protein; K07304 peptide-methionine (S... 28.9 4.5 pfa:PFL1600c conserved Plasmodium protein 28.5 5.0 sce:YML025C YML6; Mitochondrial ribosomal protein of the large... 28.5 5.1 hsa:645090 CXorf30; chromosome X open reading frame 30 28.5 hsa:79664 NARG2, BRCC1; NMDA receptor regulated 2 28.1 hsa:23329 TBC1D30, KIAA0984; TBC1 domain family, member 30 27.7 > tgo:TGME49_025470 peptide methionine sulfoxide reductase, putative (EC:1.8.4.11); K07304 peptide-methionine (S)-S-oxide reductase [EC:1.8.4.11] Length=269 Score = 70.9 bits (172), Expect = 9e-13, Method: Compositional matrix adjust. Identities = 32/64 (50%), Positives = 42/64 (65%), Gaps = 0/64 (0%) Query 2 LKISFFPQKVHLRELLTFFWTIHDPTTPDRQGPDVGPQYRSAVCVSDPTQLPLVLQIKNE 61 ++I FF KV L +LL FFW IHDPTT +RQG DVG QY SA+ V ++++E Sbjct 160 VEIQFFEDKVTLSDLLRFFWRIHDPTTLNRQGNDVGQQYGSAIFVYSAEHRQTAEELRDE 219 Query 62 MQKK 65 MQK+ Sbjct 220 MQKQ 223 > sce:YER042W MXR1; Methionine-S-sulfoxide reductase, involved in the response to oxidative stress; protects iron-sulfur clusters from oxidative inactivation along with MXR2; involved in the regulation of lifespan (EC:1.8.4.11); K07304 peptide-methionine (S)-S-oxide reductase [EC:1.8.4.11] Length=184 Score = 63.5 bits (153), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 31/66 (46%), Positives = 41/66 (62%), Gaps = 0/66 (0%) Query 2 LKISFFPQKVHLRELLTFFWTIHDPTTPDRQGPDVGPQYRSAVCVSDPTQLPLVLQIKNE 61 L++S+ P+ + LREL FF+ IHDPTT + QGPD G QYRS + L + +IK E Sbjct 78 LQVSYNPKVITLRELTDFFFRIHDPTTSNSQGPDKGTQYRSGLFAHSDADLKELAKIKEE 137 Query 62 MQKKNG 67 Q K G Sbjct 138 WQPKWG 143 > mmu:110265 Msra, 2310045J23Rik, 6530413P12Rik, MGC101976, MSR-A; methionine sulfoxide reductase A (EC:1.8.4.11); K07304 peptide-methionine (S)-S-oxide reductase [EC:1.8.4.11] Length=233 Score = 62.8 bits (151), Expect = 3e-10, Method: Compositional matrix adjust. Identities = 34/85 (40%), Positives = 45/85 (52%), Gaps = 4/85 (4%) Query 2 LKISFFPQKVHLRELLTFFWTIHDPTTPDRQGPDVGPQYRSAVCVSDPTQLPLVLQIKNE 61 +++ + P+ + ELL FW HDPT RQG D G QYRSAV + Q+ L+ K E Sbjct 117 VRVVYRPEHISFEELLKVFWENHDPTQGMRQGNDFGTQYRSAVYPTSAVQMEAALRSKEE 176 Query 62 MQKKNGISKSKLKSFPIPTNATSGQ 86 QK +SK PI T+ GQ Sbjct 177 YQKV--LSKHNFG--PITTDIREGQ 197 > dre:793910 si:dkey-221h15.1 (EC:1.8.4.11); K07304 peptide-methionine (S)-S-oxide reductase [EC:1.8.4.11] Length=235 Score = 61.2 bits (147), Expect = 8e-10, Method: Compositional matrix adjust. Identities = 28/63 (44%), Positives = 37/63 (58%), Gaps = 0/63 (0%) Query 2 LKISFFPQKVHLRELLTFFWTIHDPTTPDRQGPDVGPQYRSAVCVSDPTQLPLVLQIKNE 61 +++ F PQK+ ELL FW H+PT RQG DVG YRS++ + QL LQ + E Sbjct 117 VRVVFEPQKIKFSELLKVFWESHNPTQGMRQGNDVGTTYRSSIYTNTQEQLEQALQSREE 176 Query 62 MQK 64 QK Sbjct 177 YQK 179 > ath:AT5G61640 PMSR1; PMSR1 (PEPTIDEMETHIONINE SULFOXIDE REDUCTASE 1); oxidoreductase, acting on sulfur group of donors, disulfide as acceptor / peptide-methionine-(S)-S-oxide reductase Length=202 Score = 56.6 bits (135), Expect = 2e-08, Method: Compositional matrix adjust. Identities = 23/54 (42%), Positives = 34/54 (62%), Gaps = 0/54 (0%) Query 2 LKISFFPQKVHLRELLTFFWTIHDPTTPDRQGPDVGPQYRSAVCVSDPTQLPLV 55 +++ + P++ + LL FW+ HDPTT +RQG DVG QYRS + +P Q L Sbjct 89 VRVQYDPKECSYQSLLDLFWSKHDPTTLNRQGNDVGTQYRSGIYFYNPEQEKLA 142 > hsa:4482 MSRA, PMSR; methionine sulfoxide reductase A (EC:1.8.4.11); K07304 peptide-methionine (S)-S-oxide reductase [EC:1.8.4.11] Length=195 Score = 55.1 bits (131), Expect = 6e-08, Method: Compositional matrix adjust. Identities = 31/85 (36%), Positives = 43/85 (50%), Gaps = 4/85 (4%) Query 2 LKISFFPQKVHLRELLTFFWTIHDPTTPDRQGPDVGPQYRSAVCVSDPTQLPLVLQIKNE 61 +++ + P+ + ELL FW HDPT RQG D G QYRSA+ + Q+ L K Sbjct 79 VRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKEN 138 Query 62 MQKKNGISKSKLKSFPIPTNATSGQ 86 QK +S+ PI T+ GQ Sbjct 139 YQKV--LSEHGFG--PITTDIREGQ 159 > xla:379956 msra.1, MGC64457, msra; methionine sulfoxide reductase A, gene 1 (EC:1.8.4.11); K07304 peptide-methionine (S)-S-oxide reductase [EC:1.8.4.11] Length=211 Score = 53.9 bits (128), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 22/64 (34%), Positives = 36/64 (56%), Gaps = 0/64 (0%) Query 2 LKISFFPQKVHLRELLTFFWTIHDPTTPDRQGPDVGPQYRSAVCVSDPTQLPLVLQIKNE 61 +++ + P+ ++ +L+ FW HDPT RQG DVG YRSA+ Q L+ + + Sbjct 96 VRVVYEPESINFEKLIKVFWENHDPTQGMRQGNDVGTMYRSAIYTYTKEQTEAALKSRED 155 Query 62 MQKK 65 QK+ Sbjct 156 YQKE 159 > ath:AT4G25130 peptide methionine sulfoxide reductase, putative; K07304 peptide-methionine (S)-S-oxide reductase [EC:1.8.4.11] Length=258 Score = 52.8 bits (125), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 23/63 (36%), Positives = 34/63 (53%), Gaps = 0/63 (0%) Query 2 LKISFFPQKVHLRELLTFFWTIHDPTTPDRQGPDVGPQYRSAVCVSDPTQLPLVLQIKNE 61 +++ + P++ LL FW HDPTT +RQG DVG QYRS + Q + + + Sbjct 145 VRVQYDPKECSFESLLDVFWNRHDPTTLNRQGGDVGTQYRSGIYYYTDEQERIAREAVEK 204 Query 62 MQK 64 QK Sbjct 205 QQK 207 > ath:AT5G07470 PMSR3; PMSR3 (PEPTIDEMETHIONINE SULFOXIDE REDUCTASE 3); oxidoreductase, acting on sulfur group of donors, disulfide as acceptor / peptide-methionine-(S)-S-oxide reductase Length=202 Score = 50.4 bits (119), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 22/54 (40%), Positives = 29/54 (53%), Gaps = 0/54 (0%) Query 2 LKISFFPQKVHLRELLTFFWTIHDPTTPDRQGPDVGPQYRSAVCVSDPTQLPLV 55 +++ + LL FW+ HDPTT +RQG DVG QYRS + P Q L Sbjct 89 VRVQYDLNDCTYESLLDLFWSRHDPTTLNRQGNDVGTQYRSGIYFYTPEQEKLA 142 > ath:AT5G07460 PMSR2; PMSR2 (PEPTIDEMETHIONINE SULFOXIDE REDUCTASE 2); oxidoreductase, acting on sulfur group of donors, disulfide as acceptor / peptide-methionine-(S)-S-oxide reductase Length=218 Score = 48.9 bits (115), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 23/64 (35%), Positives = 36/64 (56%), Gaps = 0/64 (0%) Query 2 LKISFFPQKVHLRELLTFFWTIHDPTTPDRQGPDVGPQYRSAVCVSDPTQLPLVLQIKNE 61 +++ + P++ LL FW+ H+PTT +RQG +G QYRS + P Q L + + Sbjct 105 VRVQYDPKECTYETLLDLFWSRHNPTTLNRQGELLGAQYRSGIYFYTPEQEKLARESLEK 164 Query 62 MQKK 65 QKK Sbjct 165 EQKK 168 > ath:AT2G18030 peptide methionine sulfoxide reductase family protein Length=254 Score = 48.5 bits (114), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 0/54 (0%) Query 1 SLKISFFPQKVHLRELLTFFWTIHDPTTPDRQGPDVGPQYRSAVCVSDPTQLPL 54 S+++ + P+ + R+LL FW+ HD QGPDVG QYRS + + +L L Sbjct 101 SVQVEYDPRIIGYRQLLDVFWSSHDSRQVFGQGPDVGNQYRSCIFTNSTEELRL 154 > eco:b4219 msrA, ECK4215, JW4178, pms, pmsR; methionine sulfoxide reductase A (EC:1.8.4.11); K07304 peptide-methionine (S)-S-oxide reductase [EC:1.8.4.11] Length=212 Score = 44.7 bits (104), Expect = 8e-05, Method: Compositional matrix adjust. Identities = 19/44 (43%), Positives = 26/44 (59%), Gaps = 0/44 (0%) Query 1 SLKISFFPQKVHLRELLTFFWTIHDPTTPDRQGPDVGPQYRSAV 44 +++I + P + +LL FW HDP RQG D G QYRSA+ Sbjct 96 AVRIVYDPSVISYEQLLQVFWENHDPAQGMRQGNDHGTQYRSAI 139 > ath:AT2G17110 hypothetical protein Length=733 Score = 32.3 bits (72), Expect = 0.41, Method: Composition-based stats. Identities = 20/69 (28%), Positives = 38/69 (55%), Gaps = 1/69 (1%) Query 51 QLPLVLQI-KNEMQKKNGISKSKLKSFPIPTNATSGQPKTTTKSTSSRTLAATAPTGSTS 109 ++ ++L++ K+ +KN SK + P P+ +S Q T+ K+ + + + TAPT + Sbjct 331 EIAVMLEVGKHPYGRKNVSSKKLYEGTPSPSVVSSAQSSTSKKAKAEASSSVTAPTYADI 390 Query 110 ELQLRLLLR 118 E +L L R Sbjct 391 EAELALKSR 399 > dre:503993 im:7149628; K07304 peptide-methionine (S)-S-oxide reductase [EC:1.8.4.11] Length=160 Score = 30.8 bits (68), Expect = 1.2, Method: Compositional matrix adjust. Identities = 12/26 (46%), Positives = 17/26 (65%), Gaps = 0/26 (0%) Query 2 LKISFFPQKVHLRELLTFFWTIHDPT 27 +++ F P+ V L +LL FW HDPT Sbjct 134 VRVVFSPKDVSLEKLLKVFWESHDPT 159 > tpv:TP04_0626 mRNA cleavage factor protein; K14397 cleavage and polyadenylation specificity factor subunit 5 Length=226 Score = 29.6 bits (65), Expect = 2.7, Method: Compositional matrix adjust. Identities = 21/73 (28%), Positives = 29/73 (39%), Gaps = 3/73 (4%) Query 42 SAVCVSDPTQLPLVLQIKNEMQKKNGISKSKLKSFPIPTNATSGQPK---TTTKSTSSRT 98 V +S P VL +K ++ K G+ K KSF P S + T+TK Sbjct 70 CGVILSHRKGFPFVLLLKRDLDKSVGLLGGKCKSFENPKEVLSSKLARFITSTKHKHQLN 129 Query 99 LAATAPTGSTSEL 111 + T T EL Sbjct 130 IKETIETIQVGEL 142 > cpv:cgd4_3720 hypothetical protein Length=1317 Score = 29.3 bits (64), Expect = 2.9, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 26/57 (45%), Gaps = 0/57 (0%) Query 58 IKNEMQKKNGISKSKLKSFPIPTNATSGQPKTTTKSTSSRTLAATAPTGSTSELQLR 114 I+ E + ++ +K K K I +N P T T + + + P G S LQLR Sbjct 1195 IEFEFRVEDNFTKLKFKINAINSNNGENTPSTITSDDAENSPSILPPLGDISYLQLR 1251 > dre:30470 epb4.1l4, EPB41L4, nbl4, wu:fc29f06; erythrocyte protein band 4.1-like 4 Length=619 Score = 28.9 bits (63), Expect = 4.1, Method: Compositional matrix adjust. Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Query 54 LVLQIKNEMQKKNGISKSKLKSFPIPTNATSGQPKTTTKSTSSRTLAAT-APTGSTS 109 L I+ E+ +G+S+ +LK P T G P S S R+ +T APT T Sbjct 544 LWKHIQKELVDPSGLSEEQLKEIPYKKVETQGDPIKIRHSHSPRSFGSTGAPTARTE 600 > cel:F43E2.5 hypothetical protein; K07304 peptide-methionine (S)-S-oxide reductase [EC:1.8.4.11] Length=207 Score = 28.9 bits (63), Expect = 4.5, Method: Compositional matrix adjust. Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 6/49 (12%) Query 3 KISFFPQKVHLRELLTFFWTIHDPTTPDRQGPDVGPQYRSAVCVSDPTQ 51 +I+F P+ + +L FFW H+P ++ QY+SA+ + Q Sbjct 54 EITFDPKVIEYSKLTNFFWKHHNPAERRKK------QYQSAILYVNDDQ 96 > pfa:PFL1600c conserved Plasmodium protein Length=3193 Score = 28.5 bits (62), Expect = 5.0, Method: Composition-based stats. Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Query 58 IKNEMQKKNGISKSKLKSFPIPTNATSGQPKTTTKSTS 95 +KNE + K S SFPI TN + K T K+T+ Sbjct 699 LKNETENKT--RNSTYNSFPINTNTEQNKSKITRKNTN 734 > sce:YML025C YML6; Mitochondrial ribosomal protein of the large subunit, has similarity to E. coli L4 ribosomal protein and human mitoribosomal MRP-L4 protein; essential for viability, unlike most other mitoribosomal proteins Length=286 Score = 28.5 bits (62), Expect = 5.1, Method: Compositional matrix adjust. Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 0/49 (0%) Query 63 QKKNGISKSKLKSFPIPTNATSGQPKTTTKSTSSRTLAATAPTGSTSEL 111 + +NG S+ KL A G + T+ R LA TAP T+EL Sbjct 95 RSENGFSRRKLMPQKGSGRARVGDANSPTRHNGGRALARTAPNDYTTEL 143 > hsa:645090 CXorf30; chromosome X open reading frame 30 Length=633 Score = 28.5 bits (62), Expect = 5.9, Method: Compositional matrix adjust. Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 0/48 (0%) Query 28 TPDRQGPDVGPQYRSAVCVSDPTQLPLVLQIKNEMQKKNGISKSKLKS 75 TPD V P+ S DP ++P + + + E+Q ++ KSKL+S Sbjct 374 TPDLTEVLVIPKRNSHNFCEDPNEIPKIHEFEYEIQFESEAMKSKLES 421 > hsa:79664 NARG2, BRCC1; NMDA receptor regulated 2 Length=845 Score = 28.1 bits (61), Expect = 8.2, Method: Compositional matrix adjust. Identities = 21/77 (27%), Positives = 34/77 (44%), Gaps = 7/77 (9%) Query 33 GPDVGPQYRSAVCVSDPTQLPLVL--QIKNEMQKKNGISKSKLKSFPIPTNATSGQPKTT 90 G + + +C SD + L++ + KN K + S L S P N++SGQ Sbjct 420 GSEAAKTEDTVLCSSDTDEECLIIDTECKNNSDGKTAVVGSNLSSRPASPNSSSGQA--- 476 Query 91 TKSTSSRTLAATAPTGS 107 S ++T A +P S Sbjct 477 --SVGNQTNTACSPEES 491 > hsa:23329 TBC1D30, KIAA0984; TBC1 domain family, member 30 Length=761 Score = 27.7 bits (60), Expect = 9.7, Method: Compositional matrix adjust. Identities = 13/50 (26%), Positives = 29/50 (58%), Gaps = 2/50 (4%) Query 55 VLQIKNEMQKKNGISKSKLKSFPIPTNATSGQPKTTTKSTSSRTLAATAP 104 ++ +NE K NG+ ++ +FP AT+G+ ++ + ++ RT+ +P Sbjct 591 LIDEQNEASKTNGLGAAE--AFPSGCTATAGREGSSPEGSTRRTIEGQSP 638 Lambda K H 0.314 0.130 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2069971060 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40