bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_7615_orf3 Length=75 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_093580 hypothetical protein ; K09549 prefoldin subu... 65.1 5e-11 tpv:TP04_0469 hypothetical protein; K09549 prefoldin subunit 2 56.2 cpv:cgd7_4630 hypothetical protein 53.9 1e-07 pfa:PF14_0167 prefoldin subunit 2, putative; K09549 prefoldin ... 53.9 1e-07 dre:323012 pfdn2, im:6895552, wu:fb79a01, zgc:136473; prefoldi... 49.3 3e-06 sce:YEL003W GIM4, PFD2; Gim4p; K09549 prefoldin subunit 2 46.6 hsa:5202 PFDN2, PFD2; prefoldin subunit 2; K09549 prefoldin su... 45.1 6e-05 mmu:18637 Pfdn2, ESTM27, W48336; prefoldin 2; K09549 prefoldin... 44.7 8e-05 ath:AT3G22480 PDF2; prefoldin-related KE2 family protein 38.9 0.003 bbo:BBOV_II001170 18.m06087; KE2 family protein; K09549 prefol... 38.9 0.004 hsa:8517 IKBKG, AMCBX1, FIP-3, FIP3, Fip3p, IKK-gamma, IP, IP1... 33.5 0.16 cel:H20J04.5 pfd-2; PreFolDin (molecular chaperone) family mem... 31.6 0.68 hsa:23216 TBC1D1, KIAA1108, TBC, TBC1; TBC1 (tre-2/USP6, BUB2,... 30.8 1.1 dre:553337 lamb2l, fc83a09, si:dkey-32e6.1, wu:fc83a09; lamini... 30.4 1.3 xla:379675 mars, MGC69150; methionyl-tRNA synthetase, cytoplas... 30.4 1.5 mmu:16151 Ikbkg, 1110037D23Rik, AI848108, AI851264, AW124339, ... 30.0 1.7 tgo:TGME49_006580 hypothetical protein 30.0 2.0 dre:791150 gripap1, zgc:158787; GRIP1 associated protein 1 29.3 cpv:cgd6_1440 hypothetical protein 29.3 2.9 dre:100148193 dnah6; dynein, axonemal, heavy chain 6 28.9 mmu:194590 Reps2, POB1; RALBP1 associated Eps domain containin... 28.5 4.8 hsa:9185 REPS2, POB1; RALBP1 associated Eps domain containing 2 28.5 pfa:PF07_0067 conserved Plasmodium protein, unknown function 28.5 5.3 dre:565914 plekhh1, im:6897489, im:7143671, max1; pleckstrin h... 28.1 6.1 hsa:9025 RNF8, FLJ12013, KIAA0646; ring finger protein 8 (EC:6... 28.1 6.4 tgo:TGME49_105570 hypothetical protein 28.1 6.6 cel:T22B2.1 hypothetical protein 28.1 7.2 > tgo:TGME49_093580 hypothetical protein ; K09549 prefoldin subunit 2 Length=170 Score = 65.1 bits (157), Expect = 5e-11, Method: Compositional matrix adjust. Identities = 27/52 (51%), Positives = 42/52 (80%), Gaps = 0/52 (0%) Query 21 DLKQRLQRLEKERIALNNTIEELRQDSSDHQLVLDAFKDLEPSRRCYRLVGG 72 +L+Q L R+E+E++ L + I++L+QD+S+H+LVLDAF + RRCYR+VGG Sbjct 38 ELQQALHRVEREKVILVSKIQDLQQDTSEHRLVLDAFAKVNADRRCYRMVGG 89 > tpv:TP04_0469 hypothetical protein; K09549 prefoldin subunit 2 Length=114 Score = 56.2 bits (134), Expect = 2e-08, Method: Compositional matrix adjust. Identities = 25/51 (49%), Positives = 36/51 (70%), Gaps = 0/51 (0%) Query 22 LKQRLQRLEKERIALNNTIEELRQDSSDHQLVLDAFKDLEPSRRCYRLVGG 72 +K L+RLEKER+ L +E++ QDSS+H+LVL L R+CYR++GG Sbjct 7 MKATLKRLEKERVTLLGQMEDVSQDSSEHRLVLKNLSKLPSDRKCYRIIGG 57 > cpv:cgd7_4630 hypothetical protein Length=132 Score = 53.9 bits (128), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 21/50 (42%), Positives = 39/50 (78%), Gaps = 0/50 (0%) Query 23 KQRLQRLEKERIALNNTIEELRQDSSDHQLVLDAFKDLEPSRRCYRLVGG 72 ++++ +L+++ L++ I EL QDS +H LVL+AF+ ++P RRC+R++GG Sbjct 14 REKISQLDRKLKVLSSKISELSQDSKEHGLVLNAFEKVDPERRCFRVIGG 63 > pfa:PF14_0167 prefoldin subunit 2, putative; K09549 prefoldin subunit 2 Length=147 Score = 53.9 bits (128), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 25/59 (42%), Positives = 41/59 (69%), Gaps = 0/59 (0%) Query 13 APRPSGEEDLKQRLQRLEKERIALNNTIEELRQDSSDHQLVLDAFKDLEPSRRCYRLVG 71 +P S ++ K +++EK+R+ L + IEEL QD +H+LVL+A +++ RRCYR+VG Sbjct 9 SPNISEPKESKLTYEQIEKDRVQLVSKIEELYQDVVEHKLVLEALENVPSDRRCYRMVG 67 > dre:323012 pfdn2, im:6895552, wu:fb79a01, zgc:136473; prefoldin subunit 2; K09549 prefoldin subunit 2 Length=156 Score = 49.3 bits (116), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 21/57 (36%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Query 16 PSGEEDLKQRLQRLEKERIALNNTIEELRQDSSDHQLVLDAFKDLEPSRRCYRLVGG 72 PS E+ + QR+ +E+ ++ + E + ++H LV+D K+++PSR+C+RLVGG Sbjct 20 PSAEQ-VVATFQRMRQEQRSMASKAAEFEMEINEHSLVIDTLKEVDPSRKCFRLVGG 75 > sce:YEL003W GIM4, PFD2; Gim4p; K09549 prefoldin subunit 2 Length=111 Score = 46.6 bits (109), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 17/39 (43%), Positives = 24/39 (61%), Gaps = 0/39 (0%) Query 36 LNNTIEELRQDSSDHQLVLDAFKDLEPSRRCYRLVGGGF 74 L I EL D +H +V+ KD EP+R+CYR++GG Sbjct 22 LQTKIIELGHDKDEHTIVIKTLKDAEPTRKCYRMIGGAL 60 > hsa:5202 PFDN2, PFD2; prefoldin subunit 2; K09549 prefoldin subunit 2 Length=154 Score = 45.1 bits (105), Expect = 6e-05, Method: Compositional matrix adjust. Identities = 18/47 (38%), Positives = 31/47 (65%), Gaps = 0/47 (0%) Query 26 LQRLEKERIALNNTIEELRQDSSDHQLVLDAFKDLEPSRRCYRLVGG 72 RL +E+ L + EL + ++H LV+D K+++ +R+CYR+VGG Sbjct 30 FNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGG 76 > mmu:18637 Pfdn2, ESTM27, W48336; prefoldin 2; K09549 prefoldin subunit 2 Length=154 Score = 44.7 bits (104), Expect = 8e-05, Method: Compositional matrix adjust. Identities = 18/47 (38%), Positives = 31/47 (65%), Gaps = 0/47 (0%) Query 26 LQRLEKERIALNNTIEELRQDSSDHQLVLDAFKDLEPSRRCYRLVGG 72 RL +E+ L + EL + ++H LV+D K+++ +R+CYR+VGG Sbjct 30 FNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGG 76 > ath:AT3G22480 PDF2; prefoldin-related KE2 family protein Length=148 Score = 38.9 bits (89), Expect = 0.003, Method: Compositional matrix adjust. Identities = 14/37 (37%), Positives = 26/37 (70%), Gaps = 0/37 (0%) Query 36 LNNTIEELRQDSSDHQLVLDAFKDLEPSRRCYRLVGG 72 + + I +L S+H LV++A + L+ SR+C+R++GG Sbjct 33 IYSNITDLEMQVSEHSLVINAIQPLDQSRKCFRMIGG 69 > bbo:BBOV_II001170 18.m06087; KE2 family protein; K09549 prefoldin subunit 2 Length=109 Score = 38.9 bits (89), Expect = 0.004, Method: Compositional matrix adjust. Identities = 17/39 (43%), Positives = 26/39 (66%), Gaps = 0/39 (0%) Query 33 RIALNNTIEELRQDSSDHQLVLDAFKDLEPSRRCYRLVG 71 R+ L +++L Q+S++H+LVL L RRCYR+VG Sbjct 18 RLRLLGQLDDLSQESAEHKLVLKTLSTLPDDRRCYRIVG 56 > hsa:8517 IKBKG, AMCBX1, FIP-3, FIP3, Fip3p, IKK-gamma, IP, IP1, IP2, IPD2, NEMO; inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma; K07210 inhibitor of nuclear factor kappa-B kinase subunit gamma Length=487 Score = 33.5 bits (75), Expect = 0.16, Method: Compositional matrix adjust. Identities = 15/49 (30%), Positives = 31/49 (63%), Gaps = 0/49 (0%) Query 20 EDLKQRLQRLEKERIALNNTIEELRQDSSDHQLVLDAFKDLEPSRRCYR 68 EDLKQ+LQ+ E+ +A I++L++++ H++V++ L+ Y+ Sbjct 329 EDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYK 377 > cel:H20J04.5 pfd-2; PreFolDin (molecular chaperone) family member (pfd-2); K09549 prefoldin subunit 2 Length=141 Score = 31.6 bits (70), Expect = 0.68, Method: Compositional matrix adjust. Identities = 10/22 (45%), Positives = 15/22 (68%), Gaps = 0/22 (0%) Query 53 VLDAFKDLEPSRRCYRLVGGGF 74 VL+ KDLEP ++C+RL+ Sbjct 51 VLEVIKDLEPDQKCFRLISDTL 72 > hsa:23216 TBC1D1, KIAA1108, TBC, TBC1; TBC1 (tre-2/USP6, BUB2, cdc16) domain family, member 1 Length=1168 Score = 30.8 bits (68), Expect = 1.1, Method: Compositional matrix adjust. Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 0/33 (0%) Query 17 SGEEDLKQRLQRLEKERIALNNTIEELRQDSSD 49 S E LKQ + LE ER AL T+EELR+ S++ Sbjct 1120 SSESKLKQAMLTLELERSALLQTVEELRRRSAE 1152 > dre:553337 lamb2l, fc83a09, si:dkey-32e6.1, wu:fc83a09; laminin, beta 2-like Length=1838 Score = 30.4 bits (67), Expect = 1.3, Method: Compositional matrix adjust. Identities = 15/26 (57%), Positives = 19/26 (73%), Gaps = 0/26 (0%) Query 21 DLKQRLQRLEKERIALNNTIEELRQD 46 DLKQ L LEKE LNNT+ +LR++ Sbjct 1324 DLKQNLTALEKELKDLNNTLHQLRRE 1349 > xla:379675 mars, MGC69150; methionyl-tRNA synthetase, cytoplasmic (EC:6.1.1.10); K01874 methionyl-tRNA synthetase [EC:6.1.1.10] Length=905 Score = 30.4 bits (67), Expect = 1.5, Method: Compositional matrix adjust. Identities = 17/52 (32%), Positives = 30/52 (57%), Gaps = 4/52 (7%) Query 2 LNPRQMAQPQGAPRPSGEEDLKQRLQRLEKERIALNNTIEELRQDSSDHQLV 53 ++P Q A Q AP+ SG E +K+ +Q LEK+ N + EL+ ++ ++ Sbjct 825 VSPSQEAPEQQAPKASGPERVKELMQELEKQ----GNHVRELKGKKAEKSVI 872 > mmu:16151 Ikbkg, 1110037D23Rik, AI848108, AI851264, AW124339, IKK[g], NEMO; inhibitor of kappaB kinase gamma; K07210 inhibitor of nuclear factor kappa-B kinase subunit gamma Length=430 Score = 30.0 bits (66), Expect = 1.7, Method: Compositional matrix adjust. Identities = 14/49 (28%), Positives = 31/49 (63%), Gaps = 0/49 (0%) Query 20 EDLKQRLQRLEKERIALNNTIEELRQDSSDHQLVLDAFKDLEPSRRCYR 68 EDL+Q+LQ+ E+ +A I++L++++ H++V++ L+ Y+ Sbjct 272 EDLRQQLQQAEEALVAKQELIDKLKEEAEQHKIVMETVPVLKAQADIYK 320 > tgo:TGME49_006580 hypothetical protein Length=4740 Score = 30.0 bits (66), Expect = 2.0, Method: Compositional matrix adjust. Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 5/50 (10%) Query 10 PQGAPRPSG-----EEDLKQRLQRLEKERIALNNTIEELRQDSSDHQLVL 54 P GAPRPSG +E L L RL+K + T+E LR+ + + V+ Sbjct 3822 PSGAPRPSGSKPQTDEALHAELTRLQKLHGEMVLTLERLRESYLNCKAVI 3871 > dre:791150 gripap1, zgc:158787; GRIP1 associated protein 1 Length=867 Score = 29.3 bits (64), Expect = 2.9, Method: Compositional matrix adjust. Identities = 20/47 (42%), Positives = 30/47 (63%), Gaps = 8/47 (17%) Query 22 LKQRLQRLEKERIALNNTIEELRQ---DSSDHQLVLD-----AFKDL 60 ++Q++ +EKER LNNTI +L+Q D+ D Q +L+ A KDL Sbjct 594 VQQQVTEMEKEREDLNNTIGKLKQEIKDTVDGQRILEKKGSSALKDL 640 > cpv:cgd6_1440 hypothetical protein Length=711 Score = 29.3 bits (64), Expect = 2.9, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 24/39 (61%), Gaps = 0/39 (0%) Query 22 LKQRLQRLEKERIALNNTIEELRQDSSDHQLVLDAFKDL 60 + RL +LE E+ +LNN I EL ++++L +D + L Sbjct 385 INSRLSKLEIEKKSLNNYITELETSKAEYKLKIDELEHL 423 > dre:100148193 dnah6; dynein, axonemal, heavy chain 6 Length=4163 Score = 28.9 bits (63), Expect = 3.6, Method: Compositional matrix adjust. Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 3/59 (5%) Query 1 TLNPRQMAQPQGAPRPSGEED--LKQRLQRLEKERIALNNTIEELRQDSSDHQLV-LDA 56 TL P A + GE D + + Q L+++ LNNT++E++ ++ +HQL+ +DA Sbjct 787 TLPPCITAVRNTIDKAVGERDSYVDKFCQHLQQDIGQLNNTVQEVKAEAENHQLLDIDA 845 > mmu:194590 Reps2, POB1; RALBP1 associated Eps domain containing protein 2 Length=648 Score = 28.5 bits (62), Expect = 4.8, Method: Compositional matrix adjust. Identities = 12/24 (50%), Positives = 20/24 (83%), Gaps = 0/24 (0%) Query 21 DLKQRLQRLEKERIALNNTIEELR 44 +L+Q+L+ + +ERIAL N +E+LR Sbjct 620 ELQQQLKEVHQERIALENQLEQLR 643 > hsa:9185 REPS2, POB1; RALBP1 associated Eps domain containing 2 Length=659 Score = 28.5 bits (62), Expect = 4.9, Method: Compositional matrix adjust. Identities = 12/24 (50%), Positives = 20/24 (83%), Gaps = 0/24 (0%) Query 21 DLKQRLQRLEKERIALNNTIEELR 44 +L+Q+L+ + +ERIAL N +E+LR Sbjct 631 ELQQQLKEVHQERIALENQLEQLR 654 > pfa:PF07_0067 conserved Plasmodium protein, unknown function Length=1069 Score = 28.5 bits (62), Expect = 5.3, Method: Composition-based stats. Identities = 15/35 (42%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Query 18 GEEDLKQRLQRLEKERIALNNTIEELRQDSSD-HQ 51 G+ D K+ + ++EKE+I N IEEL+ S+ HQ Sbjct 407 GKYDNKELVVKIEKEKIDKNKKIEELKNISNQTHQ 441 > dre:565914 plekhh1, im:6897489, im:7143671, max1; pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 Length=1433 Score = 28.1 bits (61), Expect = 6.1, Method: Compositional matrix adjust. Identities = 13/41 (31%), Positives = 23/41 (56%), Gaps = 0/41 (0%) Query 5 RQMAQPQGAPRPSGEEDLKQRLQRLEKERIALNNTIEELRQ 45 R P G+P+P ++ L Q L+R +R ++E+LR+ Sbjct 1213 RAAMSPVGSPQPKTQQTLLQVLERFYPKRYKQECSVEQLRE 1253 > hsa:9025 RNF8, FLJ12013, KIAA0646; ring finger protein 8 (EC:6.3.2.-); K10667 E3 ubiquitin-protein ligase RNF8 [EC:6.3.2.19] Length=485 Score = 28.1 bits (61), Expect = 6.4, Method: Compositional matrix adjust. Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 4/55 (7%) Query 11 QGAPRPSGEEDLKQRLQRLEKERIALNNTIEELRQDSSDHQLVLDA-FKDLEPSR 64 QG GE+DLKQ+L + +E AL +EEL + D + ++ A K+LE ++ Sbjct 325 QGLEIAQGEKDLKQQLAQALQEHWAL---MEELNRSKKDFEAIIQAKNKELEQTK 376 > tgo:TGME49_105570 hypothetical protein Length=336 Score = 28.1 bits (61), Expect = 6.6, Method: Compositional matrix adjust. Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 0/35 (0%) Query 11 QGAPRPSGEEDLKQRLQRLEKERIALNNTIEELRQ 45 Q G + K +QRLEKE+ L IE+L+Q Sbjct 129 QAESSSGGFSECKHEIQRLEKEKFLLCEKIEKLKQ 163 > cel:T22B2.1 hypothetical protein Length=955 Score = 28.1 bits (61), Expect = 7.2, Method: Composition-based stats. Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 0/56 (0%) Query 6 QMAQPQGAPRPSGEEDLKQRLQRLEKERIALNNTIEELRQDSSDHQLVLDAFKDLE 61 Q Q A + + LK++ Q+LE++R NNT L + H++++D K E Sbjct 730 QSQQTVIAQQEKSIKSLKEKSQQLEEKRSITNNTQRLLEETEIIHKILVDTLKAQE 785 Lambda K H 0.316 0.136 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2002740660 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40