bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_7652_orf1 Length=116 Score E Sequences producing significant alignments: (Bits) Value bbo:BBOV_I004400 19.m02216; hypothetical protein; K14546 U3 sm... 112 3e-25 pfa:MAL13P1.183 conserved Plasmodium protein, unknown function 108 6e-24 tgo:TGME49_022180 hypothetical protein 104 7e-23 dre:100093703 mrpl36, si:dkey-261i16.3; mitochondrial ribosoma... 32.7 0.30 ath:AT5G20180 ribosomal protein L36 family protein; K02919 lar... 30.0 2.1 cel:C43D7.2 fbxb-65; F-box B protein family member (fbxb-65) 29.3 3.4 cel:H23L24.3 ttll-11; Tubulin Tyrosine Ligase Like family memb... 28.9 3.9 cel:K11H3.6 hypothetical protein 28.5 5.1 mmu:94066 Mrpl36, AI646041; mitochondrial ribosomal protein L36 28.5 5.7 dre:567051 si:dkey-48h7.2; K13296 cGMP-inhibited 3',5'-cyclic ... 28.5 6.0 bbo:BBOV_II002880 18.m06237; 85 kDa protein 27.7 9.7 > bbo:BBOV_I004400 19.m02216; hypothetical protein; K14546 U3 small nucleolar RNA-associated protein 5 Length=265 Score = 112 bits (280), Expect = 3e-25, Method: Compositional matrix adjust. Identities = 46/53 (86%), Positives = 50/53 (94%), Gaps = 0/53 (0%) Query 64 MWHRGVLELLCSSCRYVVRRWHVPILGVDCNANPRHKQALTSPPPRSRGIPKY 116 MWHRG L LLCSSCRYV+RRWHVPILGVDCNANPRHKQAL++P PRSRGIPK+ Sbjct 1 MWHRGTLTLLCSSCRYVIRRWHVPILGVDCNANPRHKQALSNPAPRSRGIPKH 53 > pfa:MAL13P1.183 conserved Plasmodium protein, unknown function Length=91 Score = 108 bits (269), Expect = 6e-24, Method: Compositional matrix adjust. Identities = 44/53 (83%), Positives = 50/53 (94%), Gaps = 0/53 (0%) Query 64 MWHRGVLELLCSSCRYVVRRWHVPILGVDCNANPRHKQALTSPPPRSRGIPKY 116 MWHRGVL LLC+SCRYV+ +WHVP+LGVDCNANPRHKQ L++PPPRSRGIPKY Sbjct 1 MWHRGVLSLLCNSCRYVIHKWHVPLLGVDCNANPRHKQVLSNPPPRSRGIPKY 53 > tgo:TGME49_022180 hypothetical protein Length=90 Score = 104 bits (259), Expect = 7e-23, Method: Compositional matrix adjust. Identities = 46/53 (86%), Positives = 49/53 (92%), Gaps = 0/53 (0%) Query 64 MWHRGVLELLCSSCRYVVRRWHVPILGVDCNANPRHKQALTSPPPRSRGIPKY 116 MWHRG L LLCSSCRYVVR+WHVPILGVDCNANPRHKQAL+ P PRSRGIPK+ Sbjct 1 MWHRGTLSLLCSSCRYVVRKWHVPILGVDCNANPRHKQALSVPAPRSRGIPKH 53 > dre:100093703 mrpl36, si:dkey-261i16.3; mitochondrial ribosomal protein L36 Length=116 Score = 32.7 bits (73), Expect = 0.30, Method: Compositional matrix adjust. Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 3/49 (6%) Query 53 QPILSRSPTNLMWHRGVLELLCSSCRYVVRRWHVPILGVDCNANPRHKQ 101 Q +L P+ M + L+ C+ C +V RR L V C A+PRHKQ Sbjct 68 QQLLCVQPSAGMKTKSALKKRCNECFFVRRRGR---LFVFCKAHPRHKQ 113 > ath:AT5G20180 ribosomal protein L36 family protein; K02919 large subunit ribosomal protein L36 Length=103 Score = 30.0 bits (66), Expect = 2.1, Method: Compositional matrix adjust. Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 3/38 (7%) Query 64 MWHRGVLELLCSSCRYVVRRWHVPILGVDCNANPRHKQ 101 M R ++ +C C+ V RR V ++ C++NP+HKQ Sbjct 1 MKVRSSVKKMCEFCKTVKRRGRVYVI---CSSNPKHKQ 35 > cel:C43D7.2 fbxb-65; F-box B protein family member (fbxb-65) Length=307 Score = 29.3 bits (64), Expect = 3.4, Method: Compositional matrix adjust. Identities = 16/59 (27%), Positives = 28/59 (47%), Gaps = 2/59 (3%) Query 41 SVTMSTTSPASRQPILSRSPTNLMWHRGVLELLCSSCRYVVRRWHVPILGVDCNANPRH 99 + + +S PILS + L G +LLC +C+Y++ + P+ D N +H Sbjct 146 DLDLIVSSSTWYHPILSSNRKYLTLTAGFTDLLCVNCKYLIVQ--QPVTARDLNLMLKH 202 > cel:H23L24.3 ttll-11; Tubulin Tyrosine Ligase Like family member (ttll-11) Length=707 Score = 28.9 bits (63), Expect = 3.9, Method: Composition-based stats. Identities = 21/78 (26%), Positives = 35/78 (44%), Gaps = 19/78 (24%) Query 12 RSTAMGSSQENLAPAPASNSEAVQEACSAS--VTMSTTSPASRQPILS------------ 57 RS+++ S EN P+ SNS ++ +AS T+ T+ S Q ++S Sbjct 93 RSSSLSSIMENRPPSGISNSSFIRSRNTASRRFTIDTSRAKSNQYVVSLCSKKIGIIEYP 152 Query 58 -----RSPTNLMWHRGVL 70 + P ++ WH VL Sbjct 153 DGRSDKQPCDVYWHNVVL 170 > cel:K11H3.6 hypothetical protein Length=77 Score = 28.5 bits (62), Expect = 5.1, Method: Compositional matrix adjust. Identities = 24/65 (36%), Positives = 32/65 (49%), Gaps = 13/65 (20%) Query 43 TMSTTSPASRQPILSRSP----TNLMWHRGVLELLCSSCRYVVR---RWHVPILGVDCNA 95 T+S + RQ + R+P T + L+L C SC Y +R R HV +CN Sbjct 8 TLSQGNSIIRQLLAVRNPMCQETAGFKVKSRLKLRCRSC-YFLRVEGRLHV-----ECNE 61 Query 96 NPRHK 100 NPRHK Sbjct 62 NPRHK 66 > mmu:94066 Mrpl36, AI646041; mitochondrial ribosomal protein L36 Length=102 Score = 28.5 bits (62), Expect = 5.7, Method: Compositional matrix adjust. Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 3/35 (8%) Query 67 RGVLELLCSSCRYVVRRWHVPILGVDCNANPRHKQ 101 +GV++ C C V RR IL C NP+HKQ Sbjct 68 KGVIKKRCKDCYKVKRRGRWFIL---CKTNPKHKQ 99 > dre:567051 si:dkey-48h7.2; K13296 cGMP-inhibited 3',5'-cyclic phosphodiesterase [EC:3.1.4.17] Length=1117 Score = 28.5 bits (62), Expect = 6.0, Method: Compositional matrix adjust. Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 8/58 (13%) Query 41 SVTMSTTSPASRQPILSRSPTNLMWHRGVLELLCSSCRYVVRRWHVPILGVDCNANPR 98 ++T++T PA +PIL+ P + G+ LLC + W+ PI + N R Sbjct 587 TLTLATLIPAEEKPILAPEP---LLMEGLEPLLCQ-----INNWNFPIFSLVEKTNGR 636 > bbo:BBOV_II002880 18.m06237; 85 kDa protein Length=574 Score = 27.7 bits (60), Expect = 9.7, Method: Composition-based stats. Identities = 20/79 (25%), Positives = 31/79 (39%), Gaps = 5/79 (6%) Query 21 ENLAPAPASNSEAVQEACSASVTMSTTSPASRQPILSRSPTNLMWHRGVLELLCSSCRYV 80 E A P +E T + +P P+++ TN +WH V V Sbjct 404 EKPASRPCYGGRKGEEVVVLQTTSTNQTPLKELPVVTGPSTNRLWHENV-----DIDMPV 458 Query 81 VRRWHVPILGVDCNANPRH 99 V++ ILG N +P+H Sbjct 459 VQKRLSTILGYVTNYDPKH 477 Lambda K H 0.316 0.126 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2037741960 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40