bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_7714_orf1 Length=116 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_078490 hypothetical protein ; K13125 nitric oxide s... 60.5 1e-09 pfa:PFE0900w conserved protein, unknown function; K13125 nitri... 57.4 1e-08 bbo:BBOV_II003220 18.m06270; hypothetical protein; K13125 nitr... 42.4 4e-04 cel:R05G6.4 hypothetical protein; K13125 nitric oxide synthase... 40.8 0.001 mmu:66394 Nosip, 2310061K06Rik, CGI-25, MGC115777; nitric oxid... 38.9 0.004 hsa:51070 NOSIP; nitric oxide synthase interacting protein; K1... 38.5 0.005 dre:492793 nosip, wu:fb80a11, zgc:101669; nitric oxide synthas... 36.6 0.020 xla:414557 nosip, MGC78783; nitric oxide synthase interacting ... 34.7 0.073 tpv:TP04_0271 hypothetical protein; K13125 nitric oxide syntha... 34.3 0.097 ath:AT1G61620 phosphoinositide binding; K13125 nitric oxide sy... 30.8 1.1 dre:100330548 novel protein with a Immunoglobulin V-set domain 29.6 2.7 ath:AT5G52400 CYP715A1; electron carrier/ heme binding / iron ... 29.3 3.2 cel:ZK945.4 hypothetical protein 28.9 4.1 > tgo:TGME49_078490 hypothetical protein ; K13125 nitric oxide synthase-interacting protein Length=322 Score = 60.5 bits (145), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 39/107 (36%), Positives = 44/107 (41%), Gaps = 51/107 (47%) Query 10 ARHSKNATSAPFYSYHERKKIRGQTRVENFGSSCSSYMEHRVAQLRLPQFRRFQMSRNEV 69 ARHSKNATSA FYSYHERKK++ Sbjct 3 ARHSKNATSAAFYSYHERKKLK-------------------------------------- 24 Query 70 MSLSLFLFAFAALGVGTLKGRLDTRACRRFESCWLCLSPARNPLATP 116 VGT + RLDT A RRFE+CWLC A P+ TP Sbjct 25 -------------DVGTQRERLDTDALRRFEACWLCNRTALAPVCTP 58 > pfa:PFE0900w conserved protein, unknown function; K13125 nitric oxide synthase-interacting protein Length=270 Score = 57.4 bits (137), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 32/108 (29%), Positives = 44/108 (40%), Gaps = 51/108 (47%) Query 9 MARHSKNATSAPFYSYHERKKIRGQTRVENFGSSCSSYMEHRVAQLRLPQFRRFQMSRNE 68 MARHSKN T+ P ++YHERKK++ Sbjct 1 MARHSKNNTANPIFTYHERKKVKD------------------------------------ 24 Query 69 VMSLSLFLFAFAALGVGTLKGRLDTRACRRFESCWLCLSPARNPLATP 116 VGTL+ RL + R+FE CW+CL A NP+++P Sbjct 25 ---------------VGTLRERLGKDSMRKFEQCWICLRTAENPVSSP 57 > bbo:BBOV_II003220 18.m06270; hypothetical protein; K13125 nitric oxide synthase-interacting protein Length=262 Score = 42.4 bits (98), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 28/107 (26%), Positives = 37/107 (34%), Gaps = 51/107 (47%) Query 9 MARHSKNATSAPFYSYHERKKIRGQTRVENFGSSCSSYMEHRVAQLRLPQFRRFQMSRNE 68 M RHSKN T+ P ++YHERK ++ Sbjct 1 MTRHSKNNTANPIFTYHERKNVK------------------------------------- 23 Query 69 VMSLSLFLFAFAALGVGTLKGRLDTRACRRFESCWLCLSPARNPLAT 115 T + RL + RR E CWLCLS A P++T Sbjct 24 --------------DFNTQRQRLGADSMRRCEQCWLCLSTAEKPVST 56 > cel:R05G6.4 hypothetical protein; K13125 nitric oxide synthase-interacting protein Length=310 Score = 40.8 bits (94), Expect = 0.001, Method: Compositional matrix adjust. Identities = 30/108 (27%), Positives = 39/108 (36%), Gaps = 48/108 (44%) Query 9 MARHSKNATSAPFYSYHERKKIRGQTRVENFGSSCSSYMEHRVAQLRLPQFRRFQMSRNE 68 M RH KN+T+A Y+YHER+ R A+ Sbjct 1 MTRHGKNSTAASVYTYHERR---------------------RDAK--------------- 24 Query 69 VMSLSLFLFAFAALGVGTLKGRLDTRACRRFESCWLCLSPARNPLATP 116 A G GTL RL + + F C L L P RNP+ +P Sbjct 25 ------------ASGYGTLHARLGADSIKEFHCCSLTLQPCRNPVISP 60 > mmu:66394 Nosip, 2310061K06Rik, CGI-25, MGC115777; nitric oxide synthase interacting protein; K13125 nitric oxide synthase-interacting protein Length=276 Score = 38.9 bits (89), Expect = 0.004, Method: Compositional matrix adjust. Identities = 28/108 (25%), Positives = 35/108 (32%), Gaps = 48/108 (44%) Query 9 MARHSKNATSAPFYSYHERKKIRGQTRVENFGSSCSSYMEHRVAQLRLPQFRRFQMSRNE 68 M RH KN T+ Y+YHE+KK Sbjct 1 MTRHGKNCTAGAVYTYHEKKK--------------------------------------- 21 Query 69 VMSLSLFLFAFAALGVGTLKGRLDTRACRRFESCWLCLSPARNPLATP 116 AA G GT RL A + F+ C L L P +P+ TP Sbjct 22 ---------DTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTP 60 > hsa:51070 NOSIP; nitric oxide synthase interacting protein; K13125 nitric oxide synthase-interacting protein Length=301 Score = 38.5 bits (88), Expect = 0.005, Method: Compositional matrix adjust. Identities = 28/108 (25%), Positives = 35/108 (32%), Gaps = 48/108 (44%) Query 9 MARHSKNATSAPFYSYHERKKIRGQTRVENFGSSCSSYMEHRVAQLRLPQFRRFQMSRNE 68 M RH KN T+ Y+YHE+KK Sbjct 1 MTRHGKNCTAGAVYTYHEKKK--------------------------------------- 21 Query 69 VMSLSLFLFAFAALGVGTLKGRLDTRACRRFESCWLCLSPARNPLATP 116 AA G GT RL A + F+ C L L P +P+ TP Sbjct 22 ---------DTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTP 60 > dre:492793 nosip, wu:fb80a11, zgc:101669; nitric oxide synthase interacting protein; K13125 nitric oxide synthase-interacting protein Length=304 Score = 36.6 bits (83), Expect = 0.020, Method: Compositional matrix adjust. Identities = 27/107 (25%), Positives = 35/107 (32%), Gaps = 48/107 (44%) Query 9 MARHSKNATSAPFYSYHERKKIRGQTRVENFGSSCSSYMEHRVAQLRLPQFRRFQMSRNE 68 M RH KN T+ Y+YHE++K Sbjct 1 MTRHGKNCTAGAVYTYHEKRK--------------------------------------- 21 Query 69 VMSLSLFLFAFAALGVGTLKGRLDTRACRRFESCWLCLSPARNPLAT 115 AA G GT RL A + F+ C L L P R+P+ T Sbjct 22 ---------DTAASGYGTQSVRLGKDAIKDFDCCSLSLQPCRDPVLT 59 > xla:414557 nosip, MGC78783; nitric oxide synthase interacting protein; K13125 nitric oxide synthase-interacting protein Length=298 Score = 34.7 bits (78), Expect = 0.073, Method: Compositional matrix adjust. Identities = 25/107 (23%), Positives = 34/107 (31%), Gaps = 48/107 (44%) Query 9 MARHSKNATSAPFYSYHERKKIRGQTRVENFGSSCSSYMEHRVAQLRLPQFRRFQMSRNE 68 M RH KN T+ Y+Y+E+KK Sbjct 1 MTRHGKNCTAGAVYTYYEKKK--------------------------------------- 21 Query 69 VMSLSLFLFAFAALGVGTLKGRLDTRACRRFESCWLCLSPARNPLAT 115 A G GT RL A + F+ C L L P ++P+ T Sbjct 22 ---------DTVASGYGTQTVRLSKDAVKDFDCCCLSLQPCKDPVVT 59 > tpv:TP04_0271 hypothetical protein; K13125 nitric oxide synthase-interacting protein Length=241 Score = 34.3 bits (77), Expect = 0.097, Method: Compositional matrix adjust. Identities = 12/20 (60%), Positives = 15/20 (75%), Gaps = 0/20 (0%) Query 97 RRFESCWLCLSPARNPLATP 116 R+FE CWLCL+ A P+ TP Sbjct 2 RKFEQCWLCLATAVKPVTTP 21 > ath:AT1G61620 phosphoinositide binding; K13125 nitric oxide synthase-interacting protein Length=310 Score = 30.8 bits (68), Expect = 1.1, Method: Compositional matrix adjust. Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 0/32 (0%) Query 82 LGVGTLKGRLDTRACRRFESCWLCLSPARNPL 113 LG GT + RL + + F++C LCL P +P+ Sbjct 23 LGYGTQRERLGRDSIKPFDACSLCLKPFIDPM 54 Score = 28.5 bits (62), Expect = 6.0, Method: Compositional matrix adjust. Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 0/30 (0%) Query 11 RHSKNATSAPFYSYHERKKIRGQTRVENFG 40 RHSKN +++Y E+KK+ T+ E G Sbjct 4 RHSKNNNDLAYFTYDEKKKLGYGTQRERLG 33 > dre:100330548 novel protein with a Immunoglobulin V-set domain Length=523 Score = 29.6 bits (65), Expect = 2.7, Method: Composition-based stats. Identities = 21/96 (21%), Positives = 42/96 (43%), Gaps = 16/96 (16%) Query 5 ENRAMARHSKNATSAPFYSYHERKKIR-------GQTRVENFGSSCSSYMEHRVAQLRLP 57 E + +A+ K S+P+Y+ ER K R G ++ + + Y R++ + Sbjct 239 EGKLLAKEDKETKSSPYYNADERYKGRLQLNDQTGFLTLDKMKDTDAGYYTVRISSNKQT 298 Query 58 QFRRFQM---------SRNEVMSLSLFLFAFAALGV 84 +++F + S +++L L + A LGV Sbjct 299 TYKKFAVNFTGSVVSPSAGAIIALLLVIAVVAGLGV 334 > ath:AT5G52400 CYP715A1; electron carrier/ heme binding / iron ion binding / monooxygenase/ oxygen binding Length=519 Score = 29.3 bits (64), Expect = 3.2, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Query 16 ATSAPFYSYHERKKIRGQTRVENFGSSCSSYMEHRVAQLRLPQFRRFQMSRNEV 69 A S PF + ++ KK++ + V + S S+ + H + + LP F R+Q +V Sbjct 52 APSFPFGNLNDMKKLKMASVVVD-NSKSSTIINHDIHSIALPHFARWQQEYGKV 104 > cel:ZK945.4 hypothetical protein Length=499 Score = 28.9 bits (63), Expect = 4.1, Method: Composition-based stats. Identities = 25/82 (30%), Positives = 34/82 (41%), Gaps = 20/82 (24%) Query 9 MARHSKNATSAPFYSYHERKKI----------RGQTRV---ENFGSSCSSYMEHRVA--Q 53 +A H K S P +H K I + Q R+ E F CS + EH + Sbjct 139 LAHHEKKMISTPDCQFHPGKSISLVCMRDRCKKRQNRLMCSECFLDKCSDHFEHEHSSLH 198 Query 54 LRLPQFRRFQMSRNEVMSLSLF 75 L LP+ R RN SL+L+ Sbjct 199 LELPELR-----RNICSSLALY 215 Lambda K H 0.325 0.132 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2037741960 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40