bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_7835_orf2 Length=141 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_080380 non-transmembrane antigen (EC:3.2.1.143); K0... 72.8 3e-13 cpv:cgd5_2130 chromatin associated proein with a chromodomain ... 30.0 2.4 mmu:72807 Zfp429, 2810487A22Rik, AI929863, Rsl2; zinc finger p... 29.3 3.9 sce:YDR499W LCD1, DDC2, PIE1; Essential protein required for t... 29.3 3.9 hsa:2733 GLE1, GLE1L, LCCS, LCCS1, hGLE1; GLE1 RNA export medi... 28.1 9.5 > tgo:TGME49_080380 non-transmembrane antigen (EC:3.2.1.143); K07759 poly(ADP-ribose) glycohydrolase [EC:3.2.1.143] Length=553 Score = 72.8 bits (177), Expect = 3e-13, Method: Composition-based stats. Identities = 42/123 (34%), Positives = 65/123 (52%), Gaps = 3/123 (2%) Query 21 AILLPQNPQGWQQVQQILAEVEAGKVPKTAGEYKQLFTSILTAAGNWRVDKPLRI---GP 77 AIL + W + + IL V +G P + L +L +GN R +K RI G Sbjct 47 AILRTPVEEDWGKTKYILNFVASGFGPADPQQLASLQKRLLKLSGNIRTEKNKRILQRGL 106 Query 78 LTHHLATHKNLSKSLLPFLASLARRLPDFFPSGIRHLGRDNPAVHLRRIEVLALLAALFF 137 L + LPF+A+L R+ + FPSG++++ +NP VHLR+I+V L+AA F Sbjct 107 LNYLEENPGKFFSHDLPFMATLVMRIDELFPSGLQYITPENPQVHLRKIQVFTLIAAAFL 166 Query 138 GIV 140 G++ Sbjct 167 GVI 169 > cpv:cgd5_2130 chromatin associated proein with a chromodomain at the C-terminus Length=1075 Score = 30.0 bits (66), Expect = 2.4, Method: Composition-based stats. Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 0/41 (0%) Query 69 VDKPLRIGPLTHHLATHKNLSKSLLPFLASLARRLPDFFPS 109 + P+ + P THH+ K LS S L S+ R P + S Sbjct 494 IQNPIILAPKTHHMIVKKALSNSRYWSLDSITSRCPQSYTS 534 > mmu:72807 Zfp429, 2810487A22Rik, AI929863, Rsl2; zinc finger protein 429 Length=485 Score = 29.3 bits (64), Expect = 3.9, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 28/70 (40%), Gaps = 3/70 (4%) Query 23 LLPQNPQGWQQVQQILAEVEAGKVPKTAGEYKQLFTS---ILTAAGNWRVDKPLRIGPLT 79 L Q W +Q A V G P Y +L ++T N +KP + G Sbjct 66 FLEQRQGPWDMKRQGAATVYPGITPNDPNNYSKLTNCKSLLITQRRNHIGEKPYKCGEFG 125 Query 80 HHLATHKNLS 89 L++HK LS Sbjct 126 KALSSHKTLS 135 > sce:YDR499W LCD1, DDC2, PIE1; Essential protein required for the DNA integrity checkpoint pathways; interacts physically with Mec1p; putative homolog of S. pombe Rad26 and human ATRIP; K12578 DNA damage checkpoint protein LCD1 Length=747 Score = 29.3 bits (64), Expect = 3.9, Method: Composition-based stats. Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 0/41 (0%) Query 75 IGPLTHHLATHKNLSKSLLPFLASLARRLPDFFPSGIRHLG 115 I L ++ H N SK +PFL +L ++ F PS +L Sbjct 278 IAVLIKEISVHPNESKLAVPFLVALMYQIVQFRPSATHNLA 318 > hsa:2733 GLE1, GLE1L, LCCS, LCCS1, hGLE1; GLE1 RNA export mediator homolog (yeast) Length=698 Score = 28.1 bits (61), Expect = 9.5, Method: Composition-based stats. Identities = 22/65 (33%), Positives = 34/65 (52%), Gaps = 5/65 (7%) Query 16 QQGLRAILLPQNPQGWQQVQQILAE--VEAGKVPKTAGEYKQLFTSILTAAGNWRVDKPL 73 Q G R++ + NPQG VQ LAE V+ G+ + A ++ F + A+G W + Sbjct 458 QSGGRSVSVTLNPQGLDFVQYKLAEKFVKQGE-EEVASHHEAAFPIAVVASGIWELHP-- 514 Query 74 RIGPL 78 R+G L Sbjct 515 RVGDL 519 Lambda K H 0.322 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2618291680 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40