bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_7940_orf1 Length=59 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_078500 ftsJ-like methyltransferase domain-containin... 61.2 8e-10 bbo:BBOV_I003250 19.m02092; ribosomal RNA large subunit methyl... 52.8 2e-07 cpv:cgd7_2570 adrift-like. FTSJ family RNA methylase ; K14590 ... 50.8 1e-06 tpv:TP03_0172 hypothetical protein; K14590 FtsJ methyltransfer... 45.4 5e-05 pfa:PFA_0275c conserved Plasmodium protein, unknown function 35.0 0.059 mmu:234728 Ftsjd1, AU022703, C730036L12Rik, MGC38131; FtsJ met... 28.5 6.0 dre:337685 ogt.1, fm81g08, ogt, wu:fc12b01, wu:fm81g08; O-link... 28.1 6.5 hsa:8473 OGT, FLJ23071, HRNT1, MGC22921, O-GLCNAC; O-linked N-... 28.1 6.7 xla:447694 ogt, MGC80426; O-linked N-acetylglucosamine (GlcNAc... 28.1 7.0 mmu:108155 Ogt, 1110038P24Rik, 4831420N21Rik, AI115525, Ogtl; ... 28.1 7.1 > tgo:TGME49_078500 ftsJ-like methyltransferase domain-containing protein ; K14590 FtsJ methyltransferase domain-containing protein 1 [EC:2.1.1.-] Length=1422 Score = 61.2 bits (147), Expect = 8e-10, Method: Compositional matrix adjust. Identities = 26/51 (50%), Positives = 36/51 (70%), Gaps = 0/51 (0%) Query 1 PYFEGCSPLEVLDDDELYRHSERRWISSPDGSGNICKKENIEFLWKQLTRQ 51 PY EG +P E+LDDD LYR +E W++ D +G+I KK NIEF+W +R+ Sbjct 227 PYHEGGNPSELLDDDVLYRQTEDLWLTGYDETGDIVKKRNIEFIWNHTSRE 277 > bbo:BBOV_I003250 19.m02092; ribosomal RNA large subunit methyltransferase J domain containing protein; K14590 FtsJ methyltransferase domain-containing protein 1 [EC:2.1.1.-] Length=1005 Score = 52.8 bits (125), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 23/52 (44%), Positives = 34/52 (65%), Gaps = 0/52 (0%) Query 1 PYFEGCSPLEVLDDDELYRHSERRWISSPDGSGNICKKENIEFLWKQLTRQA 52 PY EG S +E L +D LYR + W++ D SGNI K NIE++W +++R + Sbjct 197 PYHEGNSHMECLAEDILYRDTVTNWLTGSDESGNINKTANIEYIWDRVSRAS 248 > cpv:cgd7_2570 adrift-like. FTSJ family RNA methylase ; K14590 FtsJ methyltransferase domain-containing protein 1 [EC:2.1.1.-] Length=1188 Score = 50.8 bits (120), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 21/52 (40%), Positives = 33/52 (63%), Gaps = 0/52 (0%) Query 1 PYFEGCSPLEVLDDDELYRHSERRWISSPDGSGNICKKENIEFLWKQLTRQA 52 PYFEG +P +L DD +YR + R W D SG+I K NI+++W++ ++ Sbjct 177 PYFEGNNPNAILTDDIIYRDTYRAWNMGADDSGDITKVCNIDYIWQKTSKNT 228 > tpv:TP03_0172 hypothetical protein; K14590 FtsJ methyltransferase domain-containing protein 1 [EC:2.1.1.-] Length=980 Score = 45.4 bits (106), Expect = 5e-05, Method: Compositional matrix adjust. Identities = 20/50 (40%), Positives = 31/50 (62%), Gaps = 0/50 (0%) Query 1 PYFEGCSPLEVLDDDELYRHSERRWISSPDGSGNICKKENIEFLWKQLTR 50 PY+EG + VL +D L + + + W+ D SGNI K NIE++W ++R Sbjct 196 PYYEGNNHNVVLAEDILLKETYQNWLLGYDNSGNITKSCNIEYIWDHISR 245 > pfa:PFA_0275c conserved Plasmodium protein, unknown function Length=1224 Score = 35.0 bits (79), Expect = 0.059, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 21/34 (61%), Gaps = 0/34 (0%) Query 20 HSERRWISSPDGSGNICKKENIEFLWKQLTRQAH 53 + +WIS + +GNI ENIE++W + R+ + Sbjct 248 YENEKWISGINNTGNILHLENIEYVWNKTVREGN 281 > mmu:234728 Ftsjd1, AU022703, C730036L12Rik, MGC38131; FtsJ methyltransferase domain containing 1; K14590 FtsJ methyltransferase domain-containing protein 1 [EC:2.1.1.-] Length=767 Score = 28.5 bits (62), Expect = 6.0, Method: Compositional matrix adjust. Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 0/35 (0%) Query 1 PYFEGCSPLEVLDDDELYRHSERRWISSPDGSGNI 35 PY E L ++ DD L ++ W PD +G+I Sbjct 176 PYHEANDNLRMITDDRLMANTLHCWYFGPDNTGDI 210 > dre:337685 ogt.1, fm81g08, ogt, wu:fc12b01, wu:fm81g08; O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase) 1; K09667 polypeptide N-acetylglucosaminyltransferase [EC:2.4.1.-] Length=1062 Score = 28.1 bits (61), Expect = 6.5, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 0/37 (0%) Query 19 RHSERRWISSPDGSGNICKKENIEFLWKQLTRQAHPS 55 RH + W PD +G + +I F ++L R AH S Sbjct 42 RHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFS 78 > hsa:8473 OGT, FLJ23071, HRNT1, MGC22921, O-GLCNAC; O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase); K09667 polypeptide N-acetylglucosaminyltransferase [EC:2.4.1.-] Length=1046 Score = 28.1 bits (61), Expect = 6.7, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 0/37 (0%) Query 19 RHSERRWISSPDGSGNICKKENIEFLWKQLTRQAHPS 55 RH + W PD +G + +I F ++L R AH S Sbjct 42 RHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFS 78 > xla:447694 ogt, MGC80426; O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase); K09667 polypeptide N-acetylglucosaminyltransferase [EC:2.4.1.-] Length=1063 Score = 28.1 bits (61), Expect = 7.0, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 0/37 (0%) Query 19 RHSERRWISSPDGSGNICKKENIEFLWKQLTRQAHPS 55 RH + W PD +G + +I F ++L R AH S Sbjct 42 RHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFS 78 > mmu:108155 Ogt, 1110038P24Rik, 4831420N21Rik, AI115525, Ogtl; O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase); K09667 polypeptide N-acetylglucosaminyltransferase [EC:2.4.1.-] Length=1046 Score = 28.1 bits (61), Expect = 7.1, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 0/37 (0%) Query 19 RHSERRWISSPDGSGNICKKENIEFLWKQLTRQAHPS 55 RH + W PD +G + +I F ++L R AH S Sbjct 42 RHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFS 78 Lambda K H 0.318 0.139 0.461 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2073802932 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40