bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_8010_orf1 Length=70 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_069200 crooked neck-like protein 1, putative ; K128... 84.0 1e-16 tpv:TP02_0476 crooked neck protein; K12869 crooked neck 50.8 1e-06 hsa:51340 CRNKL1, CLF, CRN, Clf1, HCRN, MSTP021, SYF3; crooked... 48.9 4e-06 mmu:66877 Crnkl1, 1200013P10Rik, 5730590A01Rik, C80326, crn; C... 48.5 5e-06 ath:AT5G45990 crooked neck protein, putative / cell cycle prot... 45.4 4e-05 dre:393920 crnkl1, MGC55327, zgc:55327; crooked neck pre-mRNA ... 45.4 4e-05 bbo:BBOV_III004750 17.m07426; tetratricopeptide repeat domain ... 44.3 8e-05 ath:AT5G41770 crooked neck protein, putative / cell cycle prot... 44.3 1e-04 ath:AT3G13210 crooked neck protein, putative / cell cycle prot... 42.7 3e-04 ath:AT3G51110 crooked neck protein, putative / cell cycle prot... 41.2 8e-04 pfa:PFD0180c CGI-201 protein, short form; K12869 crooked neck 36.6 0.020 cel:M03F8.3 hypothetical protein; K12869 crooked neck 32.0 0.45 cel:C05D11.1 hypothetical protein 30.0 2.0 cpv:cgd7_3690 crooked neck protein HAT repeats ; K12869 crooke... 29.6 2.5 > tgo:TGME49_069200 crooked neck-like protein 1, putative ; K12869 crooked neck Length=794 Score = 84.0 bits (206), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 42/58 (72%), Positives = 45/58 (77%), Gaps = 0/58 (0%) Query 13 PRRGAKNYPLGASWKQMEVKNKMPAAVQITAEQLLREAVDRQLEDAAAAKPQQRIVDE 70 P NYPL S K MEVKNKMPA VQITAEQLLREAVDRQL+D + +PQQRIVDE Sbjct 15 PESAGGNYPLHRSRKMMEVKNKMPAPVQITAEQLLREAVDRQLDDLSQIRPQQRIVDE 72 > tpv:TP02_0476 crooked neck protein; K12869 crooked neck Length=657 Score = 50.8 bits (120), Expect = 1e-06, Method: Composition-based stats. Identities = 25/43 (58%), Positives = 33/43 (76%), Gaps = 2/43 (4%) Query 28 QMEVKNKMPAAVQITAEQLLREAVDRQLEDAAAAKPQQRIVDE 70 +++VKNKMPAAVQITAEQ+LR+AV+ Q ++ K Q I DE Sbjct 8 KLQVKNKMPAAVQITAEQILRDAVEWQTKEVKTTK--QTIADE 48 > hsa:51340 CRNKL1, CLF, CRN, Clf1, HCRN, MSTP021, SYF3; crooked neck pre-mRNA splicing factor-like 1 (Drosophila); K12869 crooked neck Length=848 Score = 48.9 bits (115), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 27/40 (67%), Positives = 30/40 (75%), Gaps = 1/40 (2%) Query 31 VKNKMPAAVQITAEQLLREAVDRQLEDAAAAKPQQRIVDE 70 VKNK PA VQITAEQLLREA +R+LE PQQ+I DE Sbjct 179 VKNKAPAEVQITAEQLLREAKERELE-LLPPPPQQKITDE 217 > mmu:66877 Crnkl1, 1200013P10Rik, 5730590A01Rik, C80326, crn; Crn, crooked neck-like 1 (Drosophila); K12869 crooked neck Length=690 Score = 48.5 bits (114), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 27/40 (67%), Positives = 30/40 (75%), Gaps = 1/40 (2%) Query 31 VKNKMPAAVQITAEQLLREAVDRQLEDAAAAKPQQRIVDE 70 VKNK PA VQITAEQLLREA +R+LE PQQ+I DE Sbjct 18 VKNKAPAEVQITAEQLLREAKERELE-LLPPPPQQKITDE 56 > ath:AT5G45990 crooked neck protein, putative / cell cycle protein, putative Length=673 Score = 45.4 bits (106), Expect = 4e-05, Method: Composition-based stats. Identities = 24/43 (55%), Positives = 30/43 (69%), Gaps = 2/43 (4%) Query 27 KQMEVKNKMPAAVQITAEQLLREAVDRQLEDAAAAKPQQRIVD 69 + VKNK PA VQITAEQ+LREA +RQ +A P+Q+I D Sbjct 12 RTTRVKNKTPAPVQITAEQILREARERQ--EAEIRPPKQKITD 52 > dre:393920 crnkl1, MGC55327, zgc:55327; crooked neck pre-mRNA splicing factor-like 1 (Drosophila); K12869 crooked neck Length=753 Score = 45.4 bits (106), Expect = 4e-05, Method: Compositional matrix adjust. Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 1/39 (2%) Query 31 VKNKMPAAVQITAEQLLREAVDRQLEDAAAAKPQQRIVD 69 VKNK PA VQITAEQLLREA +R+LE P+Q+I D Sbjct 17 VKNKAPAEVQITAEQLLREAKERELE-LLPPPPKQKITD 54 > bbo:BBOV_III004750 17.m07426; tetratricopeptide repeat domain containing protein; K12869 crooked neck Length=665 Score = 44.3 bits (103), Expect = 8e-05, Method: Compositional matrix adjust. Identities = 20/27 (74%), Positives = 26/27 (96%), Gaps = 0/27 (0%) Query 28 QMEVKNKMPAAVQITAEQLLREAVDRQ 54 +++VKNKMPAAVQITAEQ+LR+AV+ Q Sbjct 8 KLQVKNKMPAAVQITAEQILRDAVEWQ 34 > ath:AT5G41770 crooked neck protein, putative / cell cycle protein, putative; K12869 crooked neck Length=705 Score = 44.3 bits (103), Expect = 1e-04, Method: Composition-based stats. Identities = 23/39 (58%), Positives = 29/39 (74%), Gaps = 2/39 (5%) Query 31 VKNKMPAAVQITAEQLLREAVDRQLEDAAAAKPQQRIVD 69 VKNK PA +QITAEQ+LREA +RQ +A P+Q+I D Sbjct 30 VKNKTPAPIQITAEQILREARERQ--EAEIRPPKQKITD 66 > ath:AT3G13210 crooked neck protein, putative / cell cycle protein, putative Length=657 Score = 42.7 bits (99), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 23/43 (53%), Positives = 29/43 (67%), Gaps = 2/43 (4%) Query 27 KQMEVKNKMPAAVQITAEQLLREAVDRQLEDAAAAKPQQRIVD 69 + +VKNK PA +QITAEQ+LREA +RQ +A P Q I D Sbjct 25 RMTQVKNKTPAPIQITAEQILREARERQ--EAEFRPPNQTITD 65 > ath:AT3G51110 crooked neck protein, putative / cell cycle protein, putative Length=413 Score = 41.2 bits (95), Expect = 8e-04, Method: Composition-based stats. Identities = 23/40 (57%), Positives = 30/40 (75%), Gaps = 3/40 (7%) Query 31 VKNKMPAAVQITAEQLLREAVDRQLEDAAAAK-PQQRIVD 69 VKNK PA VQITAEQ+L+EA R+ ED+ + P+Q+I D Sbjct 8 VKNKTPAPVQITAEQVLKEA--REREDSRILRPPKQKITD 45 > pfa:PFD0180c CGI-201 protein, short form; K12869 crooked neck Length=780 Score = 36.6 bits (83), Expect = 0.020, Method: Composition-based stats. Identities = 21/44 (47%), Positives = 30/44 (68%), Gaps = 3/44 (6%) Query 27 KQMEVKNKMPAAVQITAEQLLREAVDRQLEDAAAAKPQQRIVDE 70 K+++VKNK A VQITAEQL+ EA+ +LE+ K ++DE Sbjct 6 KKLQVKNKNAAEVQITAEQLINEAL--ELEE-VEHKVNYNLIDE 46 > cel:M03F8.3 hypothetical protein; K12869 crooked neck Length=747 Score = 32.0 bits (71), Expect = 0.45, Method: Compositional matrix adjust. Identities = 18/31 (58%), Positives = 23/31 (74%), Gaps = 1/31 (3%) Query 39 VQITAEQLLREAVDRQLEDAAAAKPQQRIVD 69 +QITAEQLLREA +R+LE A P+ +I D Sbjct 31 LQITAEQLLREAKERELELIPPA-PKTKITD 60 > cel:C05D11.1 hypothetical protein Length=995 Score = 30.0 bits (66), Expect = 2.0, Method: Composition-based stats. Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Query 16 GAKNYPLGASWKQMEVKNKM--PAAVQITAEQLLREAVDRQLEDAAAA 61 GA YPL A W Q+ + + P+ + A++L EA DR+ + A Sbjct 633 GADKYPLLAKWAQIFTQGVVFDPSRIHQCAQKLAGEARDRKRDGCTVA 680 > cpv:cgd7_3690 crooked neck protein HAT repeats ; K12869 crooked neck Length=736 Score = 29.6 bits (65), Expect = 2.5, Method: Composition-based stats. Identities = 13/27 (48%), Positives = 20/27 (74%), Gaps = 0/27 (0%) Query 24 ASWKQMEVKNKMPAAVQITAEQLLREA 50 A+ ++ VKNK A +QIT EQ+L+E+ Sbjct 25 ANEQESNVKNKSFAPIQITVEQILKES 51 Lambda K H 0.313 0.130 0.370 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2024947620 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40