bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_8074_orf1 Length=79 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_042800 TGF-beta-inducible nuclear protein 1, putati... 82.8 2e-16 pfa:MAL7P1.24 cdk105, putative; K14842 ribosome biogenesis pro... 77.8 9e-15 hsa:10412 NSA2, CDK105, HCL-G1, HCLG1, HUSSY29, TINP1, YR-29; ... 76.6 2e-14 mmu:59050 Nsa2, 5730427N09Rik, LNR42, MGC118054, Nsa2p, Tinp1,... 76.6 2e-14 mmu:636306 ribosome biogenesis protein NSA2 homolog; K14842 ri... 76.6 2e-14 mmu:433230 Gm5515, EG433230; predicted gene 5515; K14842 ribos... 76.6 2e-14 xla:100381087 nsa2, cdk105, hcl-g1, hclg1, hussy-29, hussy29, ... 75.5 4e-14 cpv:cgd3_4100 conserved protein, COG SSU ribosomal protein S8E... 71.2 8e-13 dre:321769 nsa2, fb34b10, wu:fb34b10, zgc:56334; NSA2 ribosome... 70.9 1e-12 cel:W09C5.1 hypothetical protein; K14842 ribosome biogenesis p... 68.9 3e-12 sce:YER126C NSA2; Nsa2p; K14842 ribosome biogenesis protein NSA2 65.1 5e-11 bbo:BBOV_III000260 17.m07048; ribosomal protein Se8; K14842 ri... 62.8 3e-10 tpv:TP03_0821 hypothetical protein; K14842 ribosome biogenesis... 62.4 3e-10 ath:AT5G06360 ribosomal protein S8e family protein; K14842 rib... 61.2 8e-10 hsa:11276 SYNRG, AP1GBP1, FLJ34482, MGC104959, SYNG; synergin,... 32.7 0.26 mmu:217030 Synrg, AF007009, Ap1gbp1, C76297, L71-5, SYNG; syne... 32.3 0.36 ath:AT3G50370 hypothetical protein 31.2 0.86 ath:AT5G63900 PHD finger family protein 28.5 5.6 cel:C07G1.5 hgrs-1; Hepatocyte Growth factor-Regulated TK Subs... 28.1 7.6 > tgo:TGME49_042800 TGF-beta-inducible nuclear protein 1, putative ; K14842 ribosome biogenesis protein NSA2 Length=260 Score = 82.8 bits (203), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 41/66 (62%), Positives = 54/66 (81%), Gaps = 0/66 (0%) Query 8 MPQNEYIEQHKKRFGERFDAAERRRKKEAREPHERARRAKLLRGIKAKVENKKRFLEKQK 67 MPQNEYIE H+KRFG R D ER+RKK AREPH+ +++A+ LRGIK+K+ NKKR++EK Sbjct 1 MPQNEYIELHQKRFGRRLDHHERQRKKAAREPHKLSKQARRLRGIKSKLFNKKRYVEKAT 60 Query 68 MKKRIQ 73 MKK ++ Sbjct 61 MKKTLK 66 > pfa:MAL7P1.24 cdk105, putative; K14842 ribosome biogenesis protein NSA2 Length=259 Score = 77.8 bits (190), Expect = 9e-15, Method: Compositional matrix adjust. Identities = 38/66 (57%), Positives = 52/66 (78%), Gaps = 0/66 (0%) Query 8 MPQNEYIEQHKKRFGERFDAAERRRKKEAREPHERARRAKLLRGIKAKVENKKRFLEKQK 67 MPQN+YIE H+KR+G RFD E+ RKKEAR+ H+ + +AK LRGIKAK+ NKK++ EK Sbjct 1 MPQNDYIELHRKRYGYRFDHFEKERKKEARKVHKDSLKAKKLRGIKAKIYNKKKYTEKVN 60 Query 68 MKKRIQ 73 +KK ++ Sbjct 61 LKKTLK 66 > hsa:10412 NSA2, CDK105, HCL-G1, HCLG1, HUSSY29, TINP1, YR-29; NSA2 ribosome biogenesis homolog (S. cerevisiae); K14842 ribosome biogenesis protein NSA2 Length=260 Score = 76.6 bits (187), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 38/71 (53%), Positives = 57/71 (80%), Gaps = 0/71 (0%) Query 8 MPQNEYIEQHKKRFGERFDAAERRRKKEAREPHERARRAKLLRGIKAKVENKKRFLEKQK 67 MPQNEYIE H+KR+G R D E++RKKE+RE HER+++AK + G+KAK+ +K+R EK + Sbjct 1 MPQNEYIELHRKRYGYRLDYHEKKRKKESREAHERSKKAKKMIGLKAKLYHKQRHAEKIQ 60 Query 68 MKKRIQLEDRK 78 MKK I++ +++ Sbjct 61 MKKTIKMHEKR 71 > mmu:59050 Nsa2, 5730427N09Rik, LNR42, MGC118054, Nsa2p, Tinp1, Yr29; NSA2 ribosome biogenesis homolog (S. cerevisiae); K14842 ribosome biogenesis protein NSA2 Length=260 Score = 76.6 bits (187), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 38/71 (53%), Positives = 56/71 (78%), Gaps = 0/71 (0%) Query 8 MPQNEYIEQHKKRFGERFDAAERRRKKEAREPHERARRAKLLRGIKAKVENKKRFLEKQK 67 MPQNEYIE H+KR+G R D E++RKKE RE HER+++AK + G+KAK+ +K+R EK + Sbjct 1 MPQNEYIELHRKRYGYRLDYHEKKRKKEGREAHERSKKAKKMIGLKAKLYHKQRHAEKIQ 60 Query 68 MKKRIQLEDRK 78 MKK I++ +++ Sbjct 61 MKKTIKMHEKR 71 > mmu:636306 ribosome biogenesis protein NSA2 homolog; K14842 ribosome biogenesis protein NSA2 Length=260 Score = 76.6 bits (187), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 38/71 (53%), Positives = 56/71 (78%), Gaps = 0/71 (0%) Query 8 MPQNEYIEQHKKRFGERFDAAERRRKKEAREPHERARRAKLLRGIKAKVENKKRFLEKQK 67 MPQNEYIE H+KR+G R D E++RKKE RE HER+++AK + G+KAK+ +K+R EK + Sbjct 1 MPQNEYIELHRKRYGYRLDYHEKKRKKEGREAHERSKKAKKMIGLKAKLYHKQRHAEKIQ 60 Query 68 MKKRIQLEDRK 78 MKK I++ +++ Sbjct 61 MKKTIKMHEKR 71 > mmu:433230 Gm5515, EG433230; predicted gene 5515; K14842 ribosome biogenesis protein NSA2 Length=260 Score = 76.6 bits (187), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 38/71 (53%), Positives = 56/71 (78%), Gaps = 0/71 (0%) Query 8 MPQNEYIEQHKKRFGERFDAAERRRKKEAREPHERARRAKLLRGIKAKVENKKRFLEKQK 67 MPQNEYIE H+KR+G R D E++RKKE RE HER+++AK + G+KAK+ +K+R EK + Sbjct 1 MPQNEYIELHRKRYGYRLDYHEKKRKKEGREAHERSKKAKKMIGLKAKLYHKQRHAEKIQ 60 Query 68 MKKRIQLEDRK 78 MKK I++ +++ Sbjct 61 MKKTIKMHEKR 71 > xla:100381087 nsa2, cdk105, hcl-g1, hclg1, hussy-29, hussy29, tinp1, yr-29; NSA2 ribosome biogenesis homolog; K14842 ribosome biogenesis protein NSA2 Length=260 Score = 75.5 bits (184), Expect = 4e-14, Method: Compositional matrix adjust. Identities = 37/71 (52%), Positives = 57/71 (80%), Gaps = 0/71 (0%) Query 8 MPQNEYIEQHKKRFGERFDAAERRRKKEAREPHERARRAKLLRGIKAKVENKKRFLEKQK 67 MPQN+YIE H+KR+G R D E++RKKE+RE HER+++AK L G+KAK+ +K+R EK + Sbjct 1 MPQNDYIELHRKRYGYRLDYHEKKRKKESREAHERSQKAKKLIGLKAKLYHKQRHAEKIQ 60 Query 68 MKKRIQLEDRK 78 MKK +++ +++ Sbjct 61 MKKTLKMHEKR 71 > cpv:cgd3_4100 conserved protein, COG SSU ribosomal protein S8E ; K14842 ribosome biogenesis protein NSA2 Length=260 Score = 71.2 bits (173), Expect = 8e-13, Method: Compositional matrix adjust. Identities = 37/71 (52%), Positives = 53/71 (74%), Gaps = 0/71 (0%) Query 8 MPQNEYIEQHKKRFGERFDAAERRRKKEAREPHERARRAKLLRGIKAKVENKKRFLEKQK 67 MPQNEYIE H+KR G RFD E++RK E+R+ H+ ++ A+ LRGIKAK+ NKKR+ EK Sbjct 1 MPQNEYIELHRKRHGYRFDHFEKKRKFESRKVHKDSQHAQKLRGIKAKLYNKKRYAEKAT 60 Query 68 MKKRIQLEDRK 78 ++K ++ + K Sbjct 61 LRKLVKANEEK 71 > dre:321769 nsa2, fb34b10, wu:fb34b10, zgc:56334; NSA2 ribosome biogenesis homolog (S. cerevisiae); K14842 ribosome biogenesis protein NSA2 Length=260 Score = 70.9 bits (172), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 36/71 (50%), Positives = 55/71 (77%), Gaps = 0/71 (0%) Query 8 MPQNEYIEQHKKRFGERFDAAERRRKKEAREPHERARRAKLLRGIKAKVENKKRFLEKQK 67 MPQNE+IE H+KR G R D E++RKKE+RE HER+ +A+ + G+KAK+ +K+R EK + Sbjct 1 MPQNEHIELHRKRHGYRLDHHEKKRKKESREAHERSHKARKMIGLKAKLYHKQRHAEKIQ 60 Query 68 MKKRIQLEDRK 78 MKK I++ +++ Sbjct 61 MKKTIKMHEQR 71 > cel:W09C5.1 hypothetical protein; K14842 ribosome biogenesis protein NSA2 Length=259 Score = 68.9 bits (167), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 37/63 (58%), Positives = 48/63 (76%), Gaps = 0/63 (0%) Query 8 MPQNEYIEQHKKRFGERFDAAERRRKKEAREPHERARRAKLLRGIKAKVENKKRFLEKQK 67 MPQNE+IE H+KR G R D ER+RKK AR H+R++ AK LRG KAK+ +KKR+ EK + Sbjct 1 MPQNEHIELHRKRHGRRLDHEERQRKKLARAAHDRSQMAKTLRGHKAKLYHKKRYSEKVE 60 Query 68 MKK 70 M+K Sbjct 61 MRK 63 > sce:YER126C NSA2; Nsa2p; K14842 ribosome biogenesis protein NSA2 Length=261 Score = 65.1 bits (157), Expect = 5e-11, Method: Compositional matrix adjust. Identities = 35/65 (53%), Positives = 47/65 (72%), Gaps = 0/65 (0%) Query 8 MPQNEYIEQHKKRFGERFDAAERRRKKEAREPHERARRAKLLRGIKAKVENKKRFLEKQK 67 MPQN+YIE+H K+ G+R D ER+RK+EARE H+ + RA+ L G K K KKR+ EK Sbjct 1 MPQNDYIERHIKQHGKRLDHEERKRKREARESHKISERAQKLTGWKGKQFAKKRYAEKVS 60 Query 68 MKKRI 72 M+K+I Sbjct 61 MRKKI 65 > bbo:BBOV_III000260 17.m07048; ribosomal protein Se8; K14842 ribosome biogenesis protein NSA2 Length=259 Score = 62.8 bits (151), Expect = 3e-10, Method: Compositional matrix adjust. Identities = 33/65 (50%), Positives = 45/65 (69%), Gaps = 0/65 (0%) Query 8 MPQNEYIEQHKKRFGERFDAAERRRKKEAREPHERARRAKLLRGIKAKVENKKRFLEKQK 67 MPQNEYIE+H G RFD R RKK AR H +++ + +RG+KAK+ K+R+ EK + Sbjct 1 MPQNEYIERHIALHGRRFDHETRMRKKTARAAHTLSKKMQKMRGLKAKIFRKRRYAEKIE 60 Query 68 MKKRI 72 MKK+I Sbjct 61 MKKQI 65 > tpv:TP03_0821 hypothetical protein; K14842 ribosome biogenesis protein NSA2 Length=259 Score = 62.4 bits (150), Expect = 3e-10, Method: Compositional matrix adjust. Identities = 33/63 (52%), Positives = 43/63 (68%), Gaps = 0/63 (0%) Query 8 MPQNEYIEQHKKRFGERFDAAERRRKKEAREPHERARRAKLLRGIKAKVENKKRFLEKQK 67 MPQNEYIE+H K G RFD + RKK AR P ++RAK LRGIK+K+ K ++ EK + Sbjct 1 MPQNEYIERHIKLHGRRFDHLTKTRKKAARAPLRESKRAKTLRGIKSKIFKKHKYAEKIQ 60 Query 68 MKK 70 +K Sbjct 61 FRK 63 > ath:AT5G06360 ribosomal protein S8e family protein; K14842 ribosome biogenesis protein NSA2 Length=260 Score = 61.2 bits (147), Expect = 8e-10, Method: Compositional matrix adjust. Identities = 33/69 (47%), Positives = 46/69 (66%), Gaps = 0/69 (0%) Query 8 MPQNEYIEQHKKRFGERFDAAERRRKKEAREPHERARRAKLLRGIKAKVENKKRFLEKQK 67 MPQ +YI+ H+KR G R D ER+RKKEARE H+ + A+ GIK K+ KK + EK Sbjct 1 MPQGDYIDLHRKRNGYRLDHFERKRKKEAREVHKHSTMAQKSLGIKGKMIAKKNYAEKAL 60 Query 68 MKKRIQLED 76 MKK +++ + Sbjct 61 MKKTLKMHE 69 > hsa:11276 SYNRG, AP1GBP1, FLJ34482, MGC104959, SYNG; synergin, gamma Length=1236 Score = 32.7 bits (73), Expect = 0.26, Method: Composition-based stats. Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Query 10 QNEYIEQHKKRFGERFDAAERRRKKEAREPHERARRAKLLRGIKAKVENKKR 61 Q ++ E+ +KRF ++ E RK+ R+ E+ ++ +LL +K K K R Sbjct 116 QKQFAEEQQKRFEQQQKLLEEERKR--RQFEEQKQKLRLLSSVKPKTGEKSR 165 > mmu:217030 Synrg, AF007009, Ap1gbp1, C76297, L71-5, SYNG; synergin, gamma Length=1138 Score = 32.3 bits (72), Expect = 0.36, Method: Composition-based stats. Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Query 10 QNEYIEQHKKRFGERFDAAERRRKKEAREPHERARRAKLLRGIKAKVENKKR 61 Q ++ E+ +KRF ++ E RK+ R+ E+ ++ +LL +K K K R Sbjct 113 QKQFAEEQQKRFEQQQKLLEEERKR--RQFEEQKQKLRLLSSVKPKTGEKNR 162 > ath:AT3G50370 hypothetical protein Length=2156 Score = 31.2 bits (69), Expect = 0.86, Method: Composition-based stats. Identities = 26/77 (33%), Positives = 41/77 (53%), Gaps = 16/77 (20%) Query 15 EQHKKRFGERFDAAERRRKKEAREPH--------ERARRAKLLRGIKAKVENKKR-FLEK 65 E+ + R D +RR ++EARE E RRA+ LR K+K E K R F+E+ Sbjct 475 EEERLRLAREQDERQRRLEEEAREAAFRNEQERLEATRRAEELR--KSKEEEKHRLFMEE 532 Query 66 QKMK-----KRIQLEDR 77 ++ K K ++LE++ Sbjct 533 ERRKQAAKQKLLELEEK 549 > ath:AT5G63900 PHD finger family protein Length=557 Score = 28.5 bits (62), Expect = 5.6, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 29/56 (51%), Gaps = 0/56 (0%) Query 15 EQHKKRFGERFDAAERRRKKEAREPHERARRAKLLRGIKAKVENKKRFLEKQKMKK 70 +Q K R G D ++KK + E RR K+++ +K ++ ++ +K K +K Sbjct 185 DQEKIRIGLNVDVIHEQQKKRRKMASEEIRRPKMVKSLKKVLQVMEKKQQKNKHEK 240 > cel:C07G1.5 hgrs-1; Hepatocyte Growth factor-Regulated TK Substrate (HRS) family member (hgrs-1); K12182 hepatocyte growth factor-regulated tyrosine kinase substrate Length=729 Score = 28.1 bits (61), Expect = 7.6, Method: Composition-based stats. Identities = 18/67 (26%), Positives = 32/67 (47%), Gaps = 5/67 (7%) Query 12 EYIEQHKKRFGERFDAAERRRKKEAREPHERARRAKLLRGIKAKVENKKRFLEKQKMKKR 71 E ++ H GE R+ E RE HER R+ ++ + + ++ LE +MKK Sbjct 464 ESLQDHLANIGE-----ARQAIDEMREEHERKRQERMAEEQRLRQAQMQQTLEMMRMKKH 518 Query 72 IQLEDRK 78 L +++ Sbjct 519 AMLMEQR 525 Lambda K H 0.323 0.138 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2063098576 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40