bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_8094_orf1 Length=92 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_002680 mitochondrial-processing peptidase alpha sub... 78.6 5e-15 tpv:TP02_0218 ubiquinol-cytochrome C reductase complex core pr... 68.9 4e-12 bbo:BBOV_III003850 17.m07356; mitochondrial processing peptida... 59.3 3e-09 pfa:PFE1155c mitochondrial processing peptidase alpha subunit,... 42.4 4e-04 ath:AT4G32630 ARF GTPase activator/ zinc ion binding 30.8 1.1 tgo:TGME49_070670 hypothetical protein 30.0 1.7 > tgo:TGME49_002680 mitochondrial-processing peptidase alpha subunit, putative (EC:3.4.24.64); K01412 mitochondrial processing peptidase [EC:3.4.24.64] Length=563 Score = 78.6 bits (192), Expect = 5e-15, Method: Compositional matrix adjust. Identities = 33/61 (54%), Positives = 44/61 (72%), Gaps = 0/61 (0%) Query 32 AGQQPQYRRVPFVREDLSLVMQEVPDFKYYYIGNEAPSAYPYKDVPMDQPILNPDEFPEY 91 AG P+YRRVPFV+ED+ VM+EVP+FKYYY+G E Y+ +P+DQ IL P + +Y Sbjct 65 AGPAPEYRRVPFVKEDMEKVMEEVPEFKYYYVGKENTKGNVYEGIPLDQSILEPADLRDY 124 Query 92 V 92 V Sbjct 125 V 125 > tpv:TP02_0218 ubiquinol-cytochrome C reductase complex core protein II, mitochondrial precursor (EC:1.10.2.2); K01412 mitochondrial processing peptidase [EC:3.4.24.64] Length=525 Score = 68.9 bits (167), Expect = 4e-12, Method: Composition-based stats. Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 0/47 (0%) Query 36 PQYRRVPFVREDLSLVMQEVPDFKYYYIGNEAPSAYPYKDVPMDQPI 82 P Y++VPF++EDL V+ EVP+F +YY G+ YPYKDVPM +PI Sbjct 31 PDYKQVPFLKEDLDSVLSEVPEFNFYYFGSNTDEDYPYKDVPMTEPI 77 > bbo:BBOV_III003850 17.m07356; mitochondrial processing peptidase alpha subunit; K01412 mitochondrial processing peptidase [EC:3.4.24.64] Length=496 Score = 59.3 bits (142), Expect = 3e-09, Method: Composition-based stats. Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 0/45 (0%) Query 38 YRRVPFVREDLSLVMQEVPDFKYYYIGNEAPSAYPYKDVPMDQPI 82 Y +VPFV EDL VM+EVPDF++YYIG + PY +PM++ I Sbjct 8 YEKVPFVDEDLERVMEEVPDFRFYYIGRDDGGRNPYSSIPMNEEI 52 > pfa:PFE1155c mitochondrial processing peptidase alpha subunit, putative; K01412 mitochondrial processing peptidase [EC:3.4.24.64] Length=534 Score = 42.4 bits (98), Expect = 4e-04, Method: Composition-based stats. Identities = 21/62 (33%), Positives = 36/62 (58%), Gaps = 3/62 (4%) Query 30 VAAGQQPQYRRVPFVREDLSLVMQEVPDFKYYYIGNEAPSAYPYKDVPMDQPILNPDEFP 89 + G++ + +V F +E + V++EV F YYY NE YKD+P++ I+N +FP Sbjct 36 IYTGEKQNFNKVSFKKEKIEDVIKEV-KFDYYYF-NEGKKN-KYKDIPLNISIINESDFP 92 Query 90 EY 91 + Sbjct 93 PF 94 > ath:AT4G32630 ARF GTPase activator/ zinc ion binding Length=628 Score = 30.8 bits (68), Expect = 1.1, Method: Compositional matrix adjust. Identities = 22/70 (31%), Positives = 32/70 (45%), Gaps = 1/70 (1%) Query 4 LSASQRPL-ATAAPPQTTATAAPTAAAVAAGQQPQYRRVPFVREDLSLVMQEVPDFKYYY 62 L SQ P ATA P + A A+ + GQQ Q P R++ S + E F + Sbjct 544 LMTSQSPFHATALSPNSPALASHLSPGALMGQQSQVNMSPSFRQEYSGLGTEGNTFNGVH 603 Query 63 IGNEAPSAYP 72 ++A + YP Sbjct 604 TFHQANNGYP 613 > tgo:TGME49_070670 hypothetical protein Length=1320 Score = 30.0 bits (66), Expect = 1.7, Method: Compositional matrix adjust. Identities = 13/31 (41%), Positives = 20/31 (64%), Gaps = 0/31 (0%) Query 12 ATAAPPQTTATAAPTAAAVAAGQQPQYRRVP 42 T AP TT+ A+P AA + +G +P R++P Sbjct 114 GTDAPGDTTSVASPPAARLGSGGKPWGRKIP 144 Lambda K H 0.314 0.130 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2003222032 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40