bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_8141_orf1 Length=59 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_121290 pre-mRNA splicing factor 18, putative ; K128... 67.0 1e-11 cpv:cgd7_5490 PRP18 (SFM+PRP18 domains) ; K12817 pre-mRNA-spli... 49.3 3e-06 ath:AT1G03140 splicing factor Prp18 family protein; K12817 pre... 43.1 2e-04 xla:734335 prpf18, MGC85069; PRP18 pre-mRNA processing factor ... 39.3 0.003 hsa:8559 PRPF18, FLJ10210, PRP18, hPrp18; PRP18 pre-mRNA proce... 38.5 0.005 mmu:67229 Prpf18, 2810441A10Rik; PRP18 pre-mRNA processing fac... 38.5 0.005 bbo:BBOV_I003610 19.m02042; WD domain, G-beta repeat domain co... 38.1 0.006 dre:431751 prpf18, zgc:91830; PRP18 pre-mRNA processing factor... 37.4 0.013 hsa:9128 PRPF4, HPRP4, HPRP4P, PRP4, Prp4p; PRP4 pre-mRNA proc... 35.4 0.045 mmu:70052 Prpf4, 1600015H11Rik, AI874830, AW047464, MGC117717,... 35.4 0.047 pfa:PFI1115c pre-mRNA splicing factor, putative; K12817 pre-mR... 35.0 0.063 tgo:TGME49_043540 U4/U6 small nuclear ribonucleoprotein, putat... 34.7 0.078 dre:326944 prpf4, mg:ab03a02, zgc:65943; PRP4 pre-mRNA process... 34.7 0.085 dre:100334455 PRP4 pre-mRNA processing factor 4 homolog; K1266... 34.7 0.085 xla:447476 prpf4, MGC81780; PRP4 pre-mRNA processing factor 4 ... 34.3 0.11 cel:C36B1.5 prp-4; yeast PRP (splicing factor) related family ... 33.5 0.16 tpv:TP01_1183 pre-mRNA splicing factor protein; K12817 pre-mRN... 33.5 0.18 cel:F10G7.10 hypothetical protein; K11978 E3 ubiquitin-protein... 33.1 0.24 bbo:BBOV_IV011260 23.m06381; pre-mRNA splicing factor 18; K128... 32.0 0.44 ath:AT1G24570 hypothetical protein 30.8 0.99 ath:AT2G41500 EMB2776; nucleotide binding; K12662 U4/U6 small ... 30.0 1.9 pfa:MAL13P1.385 RNA binding protein, putative 29.3 3.1 ath:AT1G67850 hypothetical protein 29.3 3.5 cel:F32B6.3 hypothetical protein; K12817 pre-mRNA-splicing fac... 28.9 4.7 > tgo:TGME49_121290 pre-mRNA splicing factor 18, putative ; K12817 pre-mRNA-splicing factor 18 Length=373 Score = 67.0 bits (162), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 28/51 (54%), Positives = 40/51 (78%), Gaps = 0/51 (0%) Query 3 EVFRRLRAIKQPVTLFGETPWERYQRLCRLEVQLMDDEMPEGQKNVFLSLQ 53 E+F++LR +K+PVTLFGE+ W+RY RLC LE+ +DE+ GQ+N FL+ Q Sbjct 51 EIFKKLRKMKEPVTLFGESDWQRYTRLCELELLHHEDELMGGQRNAFLNPQ 101 > cpv:cgd7_5490 PRP18 (SFM+PRP18 domains) ; K12817 pre-mRNA-splicing factor 18 Length=337 Score = 49.3 bits (116), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 25/49 (51%), Positives = 34/49 (69%), Gaps = 1/49 (2%) Query 3 EVFRRLRAIKQPVTLFGETPWERYQRLCRLEVQ-LMDDEMPEGQKNVFL 50 E +RLR + +P+TLFGE ERY RL RLE + ++EM GQ+N+FL Sbjct 99 ETIKRLRLLGEPITLFGEDDNERYNRLRRLEFKGRTNEEMNIGQQNIFL 147 > ath:AT1G03140 splicing factor Prp18 family protein; K12817 pre-mRNA-splicing factor 18 Length=420 Score = 43.1 bits (100), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 25/51 (49%), Positives = 31/51 (60%), Gaps = 3/51 (5%) Query 3 EVFRRLRAIKQPVTLFGETPWERYQRLCRLEVQLM---DDEMPEGQKNVFL 50 EV RRLR +KQP+TLFGE R RL + + + D +M EGQ N FL Sbjct 108 EVIRRLRFLKQPMTLFGEDDQSRLDRLKYVLKEGLFEVDSDMTEGQTNDFL 158 > xla:734335 prpf18, MGC85069; PRP18 pre-mRNA processing factor 18 homolog; K12817 pre-mRNA-splicing factor 18 Length=342 Score = 39.3 bits (90), Expect = 0.003, Method: Compositional matrix adjust. Identities = 20/45 (44%), Positives = 31/45 (68%), Gaps = 2/45 (4%) Query 3 EVFRRLRAIKQPVTLFGETPWERYQRLCRLEVQLMDDEMPEGQKN 47 EV RRLR +P+ LFGET +E +QRL ++E+ + E+ +G +N Sbjct 83 EVIRRLRERGEPIRLFGETDYETFQRLRKIEI--LAPEVNKGLRN 125 > hsa:8559 PRPF18, FLJ10210, PRP18, hPrp18; PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae); K12817 pre-mRNA-splicing factor 18 Length=342 Score = 38.5 bits (88), Expect = 0.005, Method: Compositional matrix adjust. Identities = 19/45 (42%), Positives = 31/45 (68%), Gaps = 2/45 (4%) Query 3 EVFRRLRAIKQPVTLFGETPWERYQRLCRLEVQLMDDEMPEGQKN 47 EV RRLR +P+ LFGET ++ +QRL ++E+ + E+ +G +N Sbjct 83 EVIRRLRERGEPIRLFGETDYDAFQRLRKIEI--LTPEVNKGLRN 125 > mmu:67229 Prpf18, 2810441A10Rik; PRP18 pre-mRNA processing factor 18 homolog (yeast); K12817 pre-mRNA-splicing factor 18 Length=342 Score = 38.5 bits (88), Expect = 0.005, Method: Compositional matrix adjust. Identities = 19/45 (42%), Positives = 31/45 (68%), Gaps = 2/45 (4%) Query 3 EVFRRLRAIKQPVTLFGETPWERYQRLCRLEVQLMDDEMPEGQKN 47 EV RRLR +P+ LFGET ++ +QRL ++E+ + E+ +G +N Sbjct 83 EVIRRLRERGEPIRLFGETDYDAFQRLRKIEI--LTPEVNKGLRN 125 > bbo:BBOV_I003610 19.m02042; WD domain, G-beta repeat domain containing protein; K12662 U4/U6 small nuclear ribonucleoprotein PRP4 Length=524 Score = 38.1 bits (87), Expect = 0.006, Method: Composition-based stats. Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 0/55 (0%) Query 3 EVFRRLRAIKQPVTLFGETPWERYQRLCRLEVQLMDDEMPEGQKNVFLSLQKEAE 57 EV R LRA+ +P+TLFGE +ER +RL ++ + D N +S EA+ Sbjct 41 EVIRILRALIEPITLFGEGKYERRERLKKVLLFKYDRLFHGKDLNTAISTSSEAK 95 > dre:431751 prpf18, zgc:91830; PRP18 pre-mRNA processing factor 18 homolog (yeast); K12817 pre-mRNA-splicing factor 18 Length=342 Score = 37.4 bits (85), Expect = 0.013, Method: Compositional matrix adjust. Identities = 18/45 (40%), Positives = 31/45 (68%), Gaps = 2/45 (4%) Query 3 EVFRRLRAIKQPVTLFGETPWERYQRLCRLEVQLMDDEMPEGQKN 47 EV RRLR +P+ LFGE+ ++ +QRL ++E+ + E+ +G +N Sbjct 83 EVIRRLRERGEPIRLFGESDYDAFQRLRKIEI--LAPEVNKGLRN 125 > hsa:9128 PRPF4, HPRP4, HPRP4P, PRP4, Prp4p; PRP4 pre-mRNA processing factor 4 homolog (yeast); K12662 U4/U6 small nuclear ribonucleoprotein PRP4 Length=522 Score = 35.4 bits (80), Expect = 0.045, Method: Composition-based stats. Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 0/28 (0%) Query 2 TEVFRRLRAIKQPVTLFGETPWERYQRL 29 +EV LRA+ +P+TLFGE P ER +RL Sbjct 106 SEVKACLRALGEPITLFGEGPAERRERL 133 > mmu:70052 Prpf4, 1600015H11Rik, AI874830, AW047464, MGC117717, bN189G18.1; PRP4 pre-mRNA processing factor 4 homolog (yeast); K12662 U4/U6 small nuclear ribonucleoprotein PRP4 Length=521 Score = 35.4 bits (80), Expect = 0.047, Method: Composition-based stats. Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 0/28 (0%) Query 2 TEVFRRLRAIKQPVTLFGETPWERYQRL 29 +EV LRA+ +P+TLFGE P ER +RL Sbjct 105 SEVKACLRALGEPITLFGEGPAERRERL 132 > pfa:PFI1115c pre-mRNA splicing factor, putative; K12817 pre-mRNA-splicing factor 18 Length=343 Score = 35.0 bits (79), Expect = 0.063, Method: Composition-based stats. Identities = 17/47 (36%), Positives = 31/47 (65%), Gaps = 2/47 (4%) Query 3 EVFRRLRAIKQPVTLFGETPWERYQRLCRLEVQLMDDEMPEGQKNVF 49 ++ LR +K+P+ LFGET +RY RL E+++ +E+ ++N+F Sbjct 90 QIIMLLRQLKEPIRLFGETDLQRYNRL--KELKMNKNELKINEQNIF 134 > tgo:TGME49_043540 U4/U6 small nuclear ribonucleoprotein, putative (EC:2.6.1.45); K12662 U4/U6 small nuclear ribonucleoprotein PRP4 Length=711 Score = 34.7 bits (78), Expect = 0.078, Method: Compositional matrix adjust. Identities = 15/26 (57%), Positives = 19/26 (73%), Gaps = 0/26 (0%) Query 4 VFRRLRAIKQPVTLFGETPWERYQRL 29 V + LRA+ P+ LFGE P+ER QRL Sbjct 95 VRKVLRALGHPICLFGEGPFERRQRL 120 > dre:326944 prpf4, mg:ab03a02, zgc:65943; PRP4 pre-mRNA processing factor 4 homolog (yeast); K12662 U4/U6 small nuclear ribonucleoprotein PRP4 Length=507 Score = 34.7 bits (78), Expect = 0.085, Method: Composition-based stats. Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 0/44 (0%) Query 3 EVFRRLRAIKQPVTLFGETPWERYQRLCRLEVQLMDDEMPEGQK 46 EV LRA+ +P+TLFGE P ER +RL + L D + + +K Sbjct 92 EVKACLRALGEPITLFGEGPAERRERLRNVLSVLGPDALKKSKK 135 > dre:100334455 PRP4 pre-mRNA processing factor 4 homolog; K12662 U4/U6 small nuclear ribonucleoprotein PRP4 Length=507 Score = 34.7 bits (78), Expect = 0.085, Method: Composition-based stats. Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 0/44 (0%) Query 3 EVFRRLRAIKQPVTLFGETPWERYQRLCRLEVQLMDDEMPEGQK 46 EV LRA+ +P+TLFGE P ER +RL + L D + + +K Sbjct 92 EVKACLRALGEPITLFGEGPAERRERLRNVLSVLGPDALKKSKK 135 > xla:447476 prpf4, MGC81780; PRP4 pre-mRNA processing factor 4 homolog; K12662 U4/U6 small nuclear ribonucleoprotein PRP4 Length=483 Score = 34.3 bits (77), Expect = 0.11, Method: Composition-based stats. Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 0/28 (0%) Query 2 TEVFRRLRAIKQPVTLFGETPWERYQRL 29 +EV LRA+ +P+TLFGE P ER +RL Sbjct 90 SEVKACLRALGEPITLFGEGPAERRERL 117 > cel:C36B1.5 prp-4; yeast PRP (splicing factor) related family member (prp-4); K12662 U4/U6 small nuclear ribonucleoprotein PRP4 Length=496 Score = 33.5 bits (75), Expect = 0.16, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 0/39 (0%) Query 3 EVFRRLRAIKQPVTLFGETPWERYQRLCRLEVQLMDDEM 41 +V +LRA+ QP+ LFGE +R +RL L + +DE+ Sbjct 80 QVKLKLRALNQPICLFGEDALDRRERLRALLSTMSEDEI 118 > tpv:TP01_1183 pre-mRNA splicing factor protein; K12817 pre-mRNA-splicing factor 18 Length=327 Score = 33.5 bits (75), Expect = 0.18, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 24/38 (63%), Gaps = 0/38 (0%) Query 3 EVFRRLRAIKQPVTLFGETPWERYQRLCRLEVQLMDDE 40 EV +RLR ++QP+ FGE+ ER +RL E + D E Sbjct 84 EVVKRLRKLRQPIVFFGESHKERCRRLFSQETDIDDLE 121 > cel:F10G7.10 hypothetical protein; K11978 E3 ubiquitin-protein ligase UBR3 [EC:6.3.2.19] Length=1884 Score = 33.1 bits (74), Expect = 0.24, Method: Compositional matrix adjust. Identities = 18/39 (46%), Positives = 26/39 (66%), Gaps = 0/39 (0%) Query 20 ETPWERYQRLCRLEVQLMDDEMPEGQKNVFLSLQKEAEE 58 +T +ERYQRL R + LM+D M +KN+F +KE +E Sbjct 795 KTEFERYQRLVREQALLMEDMMLTPEKNLFQFDEKETDE 833 > bbo:BBOV_IV011260 23.m06381; pre-mRNA splicing factor 18; K12817 pre-mRNA-splicing factor 18 Length=285 Score = 32.0 bits (71), Expect = 0.44, Method: Compositional matrix adjust. Identities = 15/49 (30%), Positives = 31/49 (63%), Gaps = 3/49 (6%) Query 2 TEVFRRLRAIKQPVTLFGETPWERYQRLCRLEVQLMDDEMPEGQKNVFL 50 +E+ +LR K+P T+F ET +R +RL + + + + + + Q+N+F+ Sbjct 90 SEIINQLRRHKEPATIFAETREDRIERLYQAQEK---ENIAKNQQNIFV 135 > ath:AT1G24570 hypothetical protein Length=381 Score = 30.8 bits (68), Expect = 0.99, Method: Composition-based stats. Identities = 11/38 (28%), Positives = 24/38 (63%), Gaps = 0/38 (0%) Query 19 GETPWERYQRLCRLEVQLMDDEMPEGQKNVFLSLQKEA 56 G+ PW+ + C++E ++ ++ + +K+ F SLQ E+ Sbjct 336 GKAPWQGVRDRCQMEWKMFENRVEAAEKDYFRSLQVES 373 > ath:AT2G41500 EMB2776; nucleotide binding; K12662 U4/U6 small nuclear ribonucleoprotein PRP4 Length=554 Score = 30.0 bits (66), Expect = 1.9, Method: Compositional matrix adjust. Identities = 14/26 (53%), Positives = 18/26 (69%), Gaps = 0/26 (0%) Query 7 RLRAIKQPVTLFGETPWERYQRLCRL 32 RLR + +P+TLFGE ER RL +L Sbjct 129 RLRRLGEPITLFGEQEMERRARLTQL 154 > pfa:MAL13P1.385 RNA binding protein, putative Length=648 Score = 29.3 bits (64), Expect = 3.1, Method: Composition-based stats. Identities = 16/52 (30%), Positives = 28/52 (53%), Gaps = 10/52 (19%) Query 8 LRAIKQPVTLFGETPWERYQRLCRLEVQLMDDEMPEGQKNVFLSLQKEAEEE 59 LR +K+P+ LFGE +++ +RL + + D L ++K+ EEE Sbjct 62 LRLLKEPICLFGEDSYDKRKRLKNILITKYDR----------LIIKKKIEEE 103 > ath:AT1G67850 hypothetical protein Length=404 Score = 29.3 bits (64), Expect = 3.5, Method: Composition-based stats. Identities = 12/38 (31%), Positives = 19/38 (50%), Gaps = 0/38 (0%) Query 19 GETPWERYQRLCRLEVQLMDDEMPEGQKNVFLSLQKEA 56 G+ PW+ + C+ E + M +K+ F SLQ E Sbjct 358 GKAPWQGVRDRCKKEWTMFQSRMANAEKDYFKSLQVEG 395 > cel:F32B6.3 hypothetical protein; K12817 pre-mRNA-splicing factor 18 Length=352 Score = 28.9 bits (63), Expect = 4.7, Method: Composition-based stats. Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Query 2 TEVFRRLRAIKQPVTLFGETPWERYQRLCRLEVQLMDDEMPEGQKN 47 +E+ RLR P+ LFGET + +RL +LE L ++ EG +N Sbjct 88 SEIQTRLRQRNHPIMLFGETDIDVRKRLHQLE--LAQPDLNEGWEN 131 Lambda K H 0.318 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2073802932 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40