bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_8241_orf1 Length=109 Score E Sequences producing significant alignments: (Bits) Value pfa:PFI0920c dihydrouridine synthase, putative; K05539 tRNA-di... 149 3e-36 tgo:TGME49_066880 dihydrouridine synthase domain-containing pr... 135 4e-32 tpv:TP01_0028 tRNA-dihydrouridine synthase A; K05539 tRNA-dihy... 103 2e-22 eco:b4049 dusA, ECK4041, JW5950, yjbN; tRNA-dihydrouridine syn... 102 2e-22 ath:AT3G63510 FAD binding / catalytic/ tRNA dihydrouridine syn... 101 6e-22 bbo:BBOV_I002610 19.m02130; dihydrouridine synthase (Dus) doma... 99.0 3e-21 cpv:cgd2_3570 YjbN-like Dus1p tRNA dihydouriding synthase Tim ... 92.0 4e-19 ath:AT5G47970 nitrogen regulation family protein; K05539 tRNA-... 87.0 1e-17 eco:b3260 dusB, ECK3247, JW3228, yhdG; tRNA-dihydrouridine syn... 53.1 2e-07 ath:AT5G67220 nitrogen regulation family protein; K05545 tRNA-... 51.2 8e-07 sce:YML080W DUS1; Dihydrouridine synthase, member of a widespr... 50.8 1e-06 ath:AT3G49640 FAD binding / catalytic/ tRNA dihydrouridine syn... 50.1 2e-06 tgo:TGME49_080780 dihydrouridine synthase domain-containing pr... 50.1 2e-06 pfa:PF14_0086 tRNA-dihydrouridine synthase, putative; K05545 t... 47.8 1e-05 hsa:56931 DUS3L, DUS3, FLJ13896; dihydrouridine synthase 3-lik... 47.4 1e-05 eco:b2140 dusC, ECK2133, JW2128, yohI; tRNA-dihydrouridine syn... 47.4 1e-05 bbo:BBOV_IV004780 23.m05837; dihydrouridine synthase; K05542 t... 46.6 2e-05 tgo:TGME49_002790 dihydrouridine synthase domain-containing pr... 46.2 3e-05 cel:Y54E5A.6 hypothetical protein; K05543 tRNA-dihydrouridine ... 45.1 5e-05 cel:C45G9.2 hypothetical protein; K05545 tRNA-dihydrouridine s... 43.9 1e-04 dre:445096 dus4l, zgc:92033; dihydrouridine synthase 4-like (S... 43.9 1e-04 dre:100003049 dus2l; dihydrouridine synthase 2-like, SMM1 homo... 42.7 3e-04 xla:379349 dus3l, MGC53781; dihydrouridine synthase 3-like; K0... 42.4 3e-04 hsa:54920 DUS2L, DUS2, FLJ20399, SMM1, URLC8; dihydrouridine s... 42.4 4e-04 mmu:68730 Dus1l, 1110032N12Rik; dihydrouridine synthase 1-like... 42.4 4e-04 cel:F36A2.2 hypothetical protein; K05542 tRNA-dihydrouridine s... 42.0 4e-04 ath:AT4G38890 dihydrouridine synthase family protein; K05544 t... 42.0 5e-04 mmu:66369 Dus2l, 2310016K04Rik; dihydrouridine synthase 2-like... 41.6 6e-04 mmu:224907 Dus3l, AI662135, AW557805, MGC56820; dihydrouridine... 41.6 7e-04 xla:446385 dus1l, MGC83715; dihydrouridine synthase 1-like; K0... 40.4 0.001 xla:432319 MGC132093; hypothetical protein MGC78973; K05542 tR... 40.4 0.002 xla:734320 dus4l; dihydrouridine synthase 4-like; K05545 tRNA-... 40.0 0.002 sce:YNR015W SMM1, DUS2; Dihydrouridine synthase, member of a f... 39.7 0.002 hsa:64118 DUS1L, DUS1, PP3111; dihydrouridine synthase 1-like ... 39.3 0.003 dre:393647 MGC63779; zgc:63779; K05544 tRNA-dihydrouridine syn... 39.3 0.003 tgo:TGME49_072570 hypothetical protein 38.5 0.006 mmu:71916 Dus4l, 2310069P03Rik, 2700089B10Rik, AI482040, MGC13... 38.1 0.008 dre:322715 dus1l, wu:fb71f06, zgc:63748; dihydrouridine syntha... 37.4 0.013 dre:100330185 dihydrouridine synthase 1-like (S. cerevisiae)-l... 37.0 0.014 hsa:11062 DUS4L, DUS4, MGC133233, PP35; dihydrouridine synthas... 36.6 0.018 tgo:TGME49_028080 hypothetical protein ; K05544 tRNA-dihydrour... 35.8 0.036 sce:YLR401C DUS3; Dihydrouridine synthase, member of a widespr... 35.4 0.042 cel:Y37E11B.5 hypothetical protein; K05544 tRNA-dihydrouridine... 34.7 0.074 hsa:1806 DPYD, DHP, DHPDHASE, DPD, MGC132008, MGC70799; dihydr... 33.5 0.17 mmu:99586 Dpyd, AI315208, DPD, E330028L06Rik, MGC37940; dihydr... 32.7 0.32 cel:C25F6.3 dpyd-1; DihydroPYrimidine Dehydrogenase family mem... 32.3 0.41 xla:447312 dpyd, MGC81821, dhp, dhpdhase, dpd; dihydropyrimidi... 32.0 0.55 eco:b2147 yeiA, dpdB, ECK2140, JW2134; dihydropyrimidine dehyd... 31.2 0.84 dre:556707 hypothetical LOC556707 30.8 1.0 dre:405829 dpyd, MGC77205, zgc:77205; dihydropyrimidine dehydr... 30.8 1.1 > pfa:PFI0920c dihydrouridine synthase, putative; K05539 tRNA-dihydrouridine synthase A [EC:1.-.-.-] Length=577 Score = 149 bits (375), Expect = 3e-36, Method: Composition-based stats. Identities = 65/102 (63%), Positives = 85/102 (83%), Gaps = 0/102 (0%) Query 8 LGFDDVEHPIVCQLGGSNPQNVAEAATWAELAGYDEVNLNVGCPSCRVVDKGSFGAALMR 67 LGFD+ EHPIVCQLGG + +++EAA E AGYDE+N+NVGCPS +V +KG+FGA+LM+ Sbjct 247 LGFDNNEHPIVCQLGGCDMNSMSEAAILVEQAGYDEININVGCPSTKVANKGAFGASLMK 306 Query 68 SPTKVRDIVYEMKRRVQIPVTVKCRLGVDNLDSPEFTKQFVE 109 +P +VR+IVYE+K++VQIPVTVK R GVDN DS +F K F+E Sbjct 307 NPEQVRNIVYEIKKKVQIPVTVKIRTGVDNYDSFDFLKTFIE 348 > tgo:TGME49_066880 dihydrouridine synthase domain-containing protein (EC:1.3.1.2); K05539 tRNA-dihydrouridine synthase A [EC:1.-.-.-] Length=394 Score = 135 bits (340), Expect = 4e-32, Method: Compositional matrix adjust. Identities = 62/104 (59%), Positives = 80/104 (76%), Gaps = 0/104 (0%) Query 6 HTLGFDDVEHPIVCQLGGSNPQNVAEAATWAELAGYDEVNLNVGCPSCRVVDKGSFGAAL 65 L +D+EHPIVCQLGGS+P+ +AEA E G+DE+NLNVGCPS RVV +G FGAAL Sbjct 60 QNLCLEDIEHPIVCQLGGSDPKTLAEAGKLIEKLGFDEINLNVGCPSNRVVSQGCFGAAL 119 Query 66 MRSPTKVRDIVYEMKRRVQIPVTVKCRLGVDNLDSPEFTKQFVE 109 M++P VRDIV+E++R VQIPVTVK R+G D+ DS + + FV+ Sbjct 120 MKTPETVRDIVHEIRRHVQIPVTVKTRIGYDHCDSRDVLRNFVQ 163 > tpv:TP01_0028 tRNA-dihydrouridine synthase A; K05539 tRNA-dihydrouridine synthase A [EC:1.-.-.-] Length=471 Score = 103 bits (256), Expect = 2e-22, Method: Composition-based stats. Identities = 56/123 (45%), Positives = 70/123 (56%), Gaps = 22/123 (17%) Query 8 LGFDDVEHPIVCQLG----------GSNPQNVAEAATWAELAGYDEVNLNVGCPSCRVVD 57 L F++ EHPIV QLG G+ P+ + EA + GYDE+NLN GCPS RV Sbjct 144 LKFEENEHPIVAQLGIFYQHKIVPGGNCPETLVEAGRILKKFGYDEINLNAGCPSPRVSG 203 Query 58 KG------------SFGAALMRSPTKVRDIVYEMKRRVQIPVTVKCRLGVDNLDSPEFTK 105 KG FGA+LM+ VRDI + M R +++PVTVK RLGVD DS EF + Sbjct 204 KGIYKFMLKLFNLGCFGASLMKEKELVRDIAHHMLRELEMPVTVKTRLGVDEFDSYEFVR 263 Query 106 QFV 108 FV Sbjct 264 DFV 266 > eco:b4049 dusA, ECK4041, JW5950, yjbN; tRNA-dihydrouridine synthase A; K05539 tRNA-dihydrouridine synthase A [EC:1.-.-.-] Length=330 Score = 102 bits (255), Expect = 2e-22, Method: Compositional matrix adjust. Identities = 53/101 (52%), Positives = 66/101 (65%), Gaps = 1/101 (0%) Query 8 LGFDDVEHPIVCQLGGSNPQNVAEAATWAELAGYDEVNLNVGCPSCRVVDKGSFGAALMR 67 L + + EHP+ QLGGS+P +A+ A AE GYDE+NLNVGCPS R V G FGA LM Sbjct 57 LAYSEEEHPVALQLGGSDPAALAQCAKLAEARGYDEINLNVGCPSDR-VQNGMFGACLMG 115 Query 68 SPTKVRDIVYEMKRRVQIPVTVKCRLGVDNLDSPEFTKQFV 108 + V D V M+ V IPVTVK R+G+D+ DS EF F+ Sbjct 116 NAQLVADCVKAMRDVVSIPVTVKTRIGIDDQDSYEFLCDFI 156 > ath:AT3G63510 FAD binding / catalytic/ tRNA dihydrouridine synthase Length=386 Score = 101 bits (251), Expect = 6e-22, Method: Compositional matrix adjust. Identities = 49/101 (48%), Positives = 65/101 (64%), Gaps = 0/101 (0%) Query 8 LGFDDVEHPIVCQLGGSNPQNVAEAATWAELAGYDEVNLNVGCPSCRVVDKGSFGAALMR 67 L F +HPIV QLGGSN +N+A+AA ++ GYDE+NLN GCPS +V G FG +LM Sbjct 68 LAFSPQQHPIVLQLGGSNVENLAKAAKLSDAYGYDEINLNCGCPSPKVAGHGCFGVSLML 127 Query 68 SPTKVRDIVYEMKRRVQIPVTVKCRLGVDNLDSPEFTKQFV 108 P V + + + +PVTVKCR+GVDN DS + F+ Sbjct 128 KPKLVGEAMSAIAANTNVPVTVKCRIGVDNHDSYDELCDFI 168 > bbo:BBOV_I002610 19.m02130; dihydrouridine synthase (Dus) domain containing protein; K05539 tRNA-dihydrouridine synthase A [EC:1.-.-.-] Length=362 Score = 99.0 bits (245), Expect = 3e-21, Method: Compositional matrix adjust. Identities = 52/98 (53%), Positives = 63/98 (64%), Gaps = 0/98 (0%) Query 11 DDVEHPIVCQLGGSNPQNVAEAATWAELAGYDEVNLNVGCPSCRVVDKGSFGAALMRSPT 70 D EHPIV QLGG+N ++++A A GY E NLNVGCPS RV KG FGAALM Sbjct 69 DANEHPIVLQLGGNNLDSLSKAGNIALGYGYTEFNLNVGCPSTRVSGKGCFGAALMNDAP 128 Query 71 KVRDIVYEMKRRVQIPVTVKCRLGVDNLDSPEFTKQFV 108 V IV ++ + PVTVK RLGVD+ DS EF + F+ Sbjct 129 LVGRIVKHLRSELGTPVTVKHRLGVDHNDSYEFVRDFI 166 > cpv:cgd2_3570 YjbN-like Dus1p tRNA dihydouriding synthase Tim barrel ; K05539 tRNA-dihydrouridine synthase A [EC:1.-.-.-] Length=519 Score = 92.0 bits (227), Expect = 4e-19, Method: Composition-based stats. Identities = 44/104 (42%), Positives = 65/104 (62%), Gaps = 6/104 (5%) Query 11 DDVEHPIVCQLGGSNPQNVAEAATWAELAGYDEVNLNVGCPSCRVVDKGSFGAALMRSPT 70 +D+E+P+V QLGG+NPQ + +A A G+ NLNVGCPSC+V KGSFGA+L ++P Sbjct 85 NDIENPLVLQLGGNNPQKMEKAIEIAYKYGFQNFNLNVGCPSCKVASKGSFGASLFKNPL 144 Query 71 KVRDIVYEMKRR------VQIPVTVKCRLGVDNLDSPEFTKQFV 108 +V IV ++ V ++VK R+GVD D+ + F+ Sbjct 145 RVAKIVDTCNKKLIHLGLVNKRISVKTRIGVDQYDTYQHLYNFI 188 > ath:AT5G47970 nitrogen regulation family protein; K05539 tRNA-dihydrouridine synthase A [EC:1.-.-.-] Length=387 Score = 87.0 bits (214), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 43/93 (46%), Positives = 56/93 (60%), Gaps = 0/93 (0%) Query 8 LGFDDVEHPIVCQLGGSNPQNVAEAATWAELAGYDEVNLNVGCPSCRVVDKGSFGAALMR 67 L F +HPIV Q+GG N +N+A+A A YDE+N N GCPS +V +G FGA LM Sbjct 59 LAFSPDQHPIVLQIGGRNLENLAKATRLANAYAYDEINFNCGCPSPKVSGRGCFGALLML 118 Query 68 SPTKVRDIVYEMKRRVQIPVTVKCRLGVDNLDS 100 P V + + + VTVKCR+GVD+ DS Sbjct 119 DPKFVGEAMSVIAANTNAAVTVKCRIGVDDHDS 151 > eco:b3260 dusB, ECK3247, JW3228, yhdG; tRNA-dihydrouridine synthase B; K05540 tRNA-dihydrouridine synthase B [EC:1.-.-.-] Length=321 Score = 53.1 bits (126), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 27/75 (36%), Positives = 49/75 (65%), Gaps = 1/75 (1%) Query 20 QLGGSNPQNVAEAATWAELAGYDEVNLNVGCPSCRVVDKGSFGAALMRSPTKVRDIVYEM 79 Q+ GS+P+ +A+AA +G +++N+GCP+ + V++ G+AL++ P V+ I+ E+ Sbjct 70 QIAGSDPKEMADAARINVESGAQIIDINMGCPA-KKVNRKLAGSALLQYPDVVKSILTEV 128 Query 80 KRRVQIPVTVKCRLG 94 V +PVT+K R G Sbjct 129 VNAVDVPVTLKIRTG 143 > ath:AT5G67220 nitrogen regulation family protein; K05545 tRNA-dihydrouridine synthase 4 [EC:1.-.-.-] Length=423 Score = 51.2 bits (121), Expect = 8e-07, Method: Compositional matrix adjust. Identities = 29/106 (27%), Positives = 56/106 (52%), Gaps = 2/106 (1%) Query 2 QYRTHTLGFDDVEHPIVCQLGGSNPQNVAEAATWAELAGYDEVNLNVGCPSCRVVDKGSF 61 +YR + P+ Q ++P + EAA E D V++N+GCP R+ +G++ Sbjct 130 KYRNQEFTTCKEDRPLFVQFCANDPDTLLEAAKRVE-PYCDYVDINLGCPQ-RIARRGNY 187 Query 62 GAALMRSPTKVRDIVYEMKRRVQIPVTVKCRLGVDNLDSPEFTKQF 107 GA LM + V+ +V ++ + + +PV+ K R+ + D+ ++ K Sbjct 188 GAFLMDNLPLVKSLVEKLAQNLNVPVSCKIRIFPNLEDTLKYAKML 233 > sce:YML080W DUS1; Dihydrouridine synthase, member of a widespread family of conserved proteins including Smm1p, Dus3p, and Dus4p; modifies pre-tRNA(Phe) at U17 (EC:1.-.-.-); K05542 tRNA-dihydrouridine synthase 1 [EC:1.-.-.-] Length=423 Score = 50.8 bits (120), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 29/103 (28%), Positives = 54/103 (52%), Gaps = 2/103 (1%) Query 7 TLGFDDVEHPIVCQLGGSNPQNVAEAATWAELAGYDEVNLNVGCPSCRVVDKGSFGAALM 66 +L V+ P+V Q ++P+ + AA E D V+LN+GCP + KG +G+ LM Sbjct 79 SLDGSSVDRPLVVQFCANDPEYLLAAAKLVE-DKCDAVDLNLGCPQG-IAKKGHYGSFLM 136 Query 67 RSPTKVRDIVYEMKRRVQIPVTVKCRLGVDNLDSPEFTKQFVE 109 + +++ + + +++PVT K R+ D S + K ++ Sbjct 137 EEWDLIHNLINTLHKNLKVPVTAKIRIFDDCEKSLNYAKMVLD 179 > ath:AT3G49640 FAD binding / catalytic/ tRNA dihydrouridine synthase; K05543 tRNA-dihydrouridine synthase 2 [EC:1.-.-.-] Length=290 Score = 50.1 bits (118), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 30/99 (30%), Positives = 53/99 (53%), Gaps = 6/99 (6%) Query 11 DDVEHPIVCQLGGSNPQNVAEAATWAELAGYD--EVNLNVGCPSCRVVDKGSFGAALMRS 68 D+ + +V Q+G S+ +A+ E+ D +++N+GCP + +G GAAL+ Sbjct 33 DEEKSRVVFQMGTSDAVRALKAS---EIVCNDVATIDINMGCPKAFSI-QGGMGAALLSK 88 Query 69 PTKVRDIVYEMKRRVQIPVTVKCRLGVDNLDSPEFTKQF 107 P + DI+ +KR + +PVT K RL D+ E ++ Sbjct 89 PELIHDILATLKRNLDVPVTCKIRLLKSPADTVELARRI 127 > tgo:TGME49_080780 dihydrouridine synthase domain-containing protein ; K05543 tRNA-dihydrouridine synthase 2 [EC:1.-.-.-] Length=653 Score = 50.1 bits (118), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 30/79 (37%), Positives = 45/79 (56%), Gaps = 6/79 (7%) Query 17 IVCQLGGSNPQNVAEAATWAELAGYD--EVNLNVGCPSCRVVDKGSFGAALMRSPTKVRD 74 +V QLG S+ +AA L D V++N+GCP ++ G GAAL+++P D Sbjct 327 VVMQLGTSDATRALKAAM---LVAQDVAAVDVNMGCPKSFSIN-GGMGAALLKTPLIATD 382 Query 75 IVYEMKRRVQIPVTVKCRL 93 I+ ++R + IPVT K RL Sbjct 383 ILKTLRRNLDIPVTCKIRL 401 > pfa:PF14_0086 tRNA-dihydrouridine synthase, putative; K05545 tRNA-dihydrouridine synthase 4 [EC:1.-.-.-] Length=340 Score = 47.8 bits (112), Expect = 1e-05, Method: Composition-based stats. Identities = 26/96 (27%), Positives = 54/96 (56%), Gaps = 3/96 (3%) Query 2 QYRTHTLGFDDVEHPIVCQLGGSNPQNVAEAATWAELAGYDEVNLNVGCPSCRVVDKGSF 61 +YR D++ P++ Q G++ + + EA + + + V++N+GCP ++ KG++ Sbjct 68 KYRKGYFKSCDMDKPVIAQFCGNDSKILLEAINFIK-DDVNAVDINLGCPQ-QIAKKGNY 125 Query 62 GAALMRSPTKVRDIVYEMKRRVQIPVTVKCRLGVDN 97 GA L+ +V +++ ++ IP+T K R +DN Sbjct 126 GAFLLHKHDEVVNLISDITNNCVIPITCKIR-KIDN 160 > hsa:56931 DUS3L, DUS3, FLJ13896; dihydrouridine synthase 3-like (S. cerevisiae); K05544 tRNA-dihydrouridine synthase 3 [EC:1.-.-.-] Length=408 Score = 47.4 bits (111), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 31/77 (40%), Positives = 42/77 (54%), Gaps = 2/77 (2%) Query 20 QLGGSNPQNVAEAA-TWAELAGYDEVNLNVGCPSCRVVDKGSFGAALMRSPTKVRDIVYE 78 QL G+ P + + A + D V++NVGCP V KG G ALM TK + IV Sbjct 123 QLEGAFPDTMTKCAELLSRTVEVDFVDINVGCPIDLVYKKGG-GCALMNRSTKFQQIVRG 181 Query 79 MKRRVQIPVTVKCRLGV 95 M + + +P+TVK R GV Sbjct 182 MNQVLDVPLTVKIRTGV 198 > eco:b2140 dusC, ECK2133, JW2128, yohI; tRNA-dihydrouridine synthase C; K05541 tRNA-dihydrouridine synthase C [EC:1.-.-.-] Length=315 Score = 47.4 bits (111), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 32/80 (40%), Positives = 43/80 (53%), Gaps = 3/80 (3%) Query 20 QLGGSNPQNVAEAATWAELAGYDEVNLNVGCPSCRVVDKGSFGAALMRSPTKVRDIVYEM 79 QL G PQ +AE A A G V+LN GCPS + V+ GA L++ P + M Sbjct 68 QLLGQFPQWLAENAARAVELGSWGVDLNCGCPS-KTVNGSGGGATLLKDPELIYQGAKAM 126 Query 80 KRRV--QIPVTVKCRLGVDN 97 + V +PV+VK RLG D+ Sbjct 127 REAVPAHLPVSVKVRLGWDS 146 > bbo:BBOV_IV004780 23.m05837; dihydrouridine synthase; K05542 tRNA-dihydrouridine synthase 1 [EC:1.-.-.-] Length=355 Score = 46.6 bits (109), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 30/92 (32%), Positives = 46/92 (50%), Gaps = 4/92 (4%) Query 2 QYRTHTLGFDDVEHPIVCQLGGSNPQNVAEAATWAELAGY-DEVNLNVGCPSCRVVDKGS 60 +YR D + P++ Q+ G + + +AA L G+ V+LN+GCP + G Sbjct 54 KYRAVHFQTSDDDRPLIAQVCGDDAGTITQAARL--LKGHVSAVDLNLGCPQA-IAKDGH 110 Query 61 FGAALMRSPTKVRDIVYEMKRRVQIPVTVKCR 92 +G+ L+ P V IV + R V I VT K R Sbjct 111 YGSFLLDEPDLVTGIVSRVTREVGIAVTCKIR 142 > tgo:TGME49_002790 dihydrouridine synthase domain-containing protein (EC:5.1.3.9); K05542 tRNA-dihydrouridine synthase 1 [EC:1.-.-.-] Length=540 Score = 46.2 bits (108), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 25/81 (30%), Positives = 42/81 (51%), Gaps = 2/81 (2%) Query 12 DVEHPIVCQLGGSNPQNVAEAATWAELAGYDEVNLNVGCPSCRVVDKGSFGAALMRSPTK 71 + + P+ Q G +P + AA E + V++N GCP + +G +GA L+ P Sbjct 138 EFDEPVFVQFCGDSPATLLAAAQLVE-DEVEAVDVNFGCPQG-IARRGHYGAFLLNEPEL 195 Query 72 VRDIVYEMKRRVQIPVTVKCR 92 + DIV + + ++ PVT K R Sbjct 196 LVDIVSTLHKHLKTPVTCKMR 216 > cel:Y54E5A.6 hypothetical protein; K05543 tRNA-dihydrouridine synthase 2 [EC:1.-.-.-] Length=436 Score = 45.1 bits (105), Expect = 5e-05, Method: Compositional matrix adjust. Identities = 31/94 (32%), Positives = 53/94 (56%), Gaps = 10/94 (10%) Query 18 VCQLGGSNPQNVAEAATWAELAGYD--EVNLNVGCPSCRVVDKGSFGAALMRSPTKVRDI 75 + Q+G ++ + +AA A++ G D +++N+GCP + G GAAL+ K+ DI Sbjct 79 ILQIGTNSGE---KAAKIAQIVGDDVAGIDVNMGCPKPFSIHCG-MGAALLTQTEKIVDI 134 Query 76 VYEMKRRVQIPVTVKCRLGVDNLDSPEFTKQFVE 109 + +K ++PVT K R+ LD PE T + V+ Sbjct 135 LTSLKSAAKVPVTCKIRV----LDDPEDTLKLVQ 164 > cel:C45G9.2 hypothetical protein; K05545 tRNA-dihydrouridine synthase 4 [EC:1.-.-.-] Length=284 Score = 43.9 bits (102), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 30/96 (31%), Positives = 49/96 (51%), Gaps = 5/96 (5%) Query 4 RTHTLGFDDVEHPIVCQLGGSNPQNVAEAATWAELAGYDEVNLNVGCPSCRVVDKGSFGA 63 R+ L + + P++ Q +P ++EAA V+LN GCP V KG FG+ Sbjct 38 RSSELSVCEGDSPLIVQFATDDPFVLSEAAEMVYKCSTG-VDLNCGCPKHDVRSKG-FGS 95 Query 64 ALMRSPTKVRDIVYEMKRRVQIP---VTVKCRLGVD 96 AL+ P + D+V + + R+ P V++K R+ D Sbjct 96 ALLSKPELLADMVRQTRARIPDPDFSVSLKIRINHD 131 > dre:445096 dus4l, zgc:92033; dihydrouridine synthase 4-like (S. cerevisiae); K05545 tRNA-dihydrouridine synthase 4 [EC:1.-.-.-] Length=285 Score = 43.9 bits (102), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 26/86 (30%), Positives = 46/86 (53%), Gaps = 5/86 (5%) Query 14 EHPIVCQLGGSNPQNVAEAATWAELAGYDEVNLNVGCPSCRVVDKGSFGAALMRSPTKVR 73 + P++ Q + Q +A+AA D V+LN GCP + +G +GA L+ P V+ Sbjct 48 DRPLIVQFAAKDAQTLADAACVVSPFS-DGVDLNCGCPQRWAMSEG-YGACLINKPELVK 105 Query 74 DIVYEMKRRVQIP---VTVKCRLGVD 96 D+V ++ ++ P V++K R+ D Sbjct 106 DMVRHVRNQIDNPNYAVSIKIRIHKD 131 > dre:100003049 dus2l; dihydrouridine synthase 2-like, SMM1 homolog (S. cerevisiae); K05543 tRNA-dihydrouridine synthase 2 [EC:1.-.-.-] Length=504 Score = 42.7 bits (99), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 2/77 (2%) Query 17 IVCQLGGSNPQNVAEAATWAELAGYDEVNLNVGCPSCRVVDKGSFGAALMRSPTKVRDIV 76 +V Q+G ++P+ A E V++N+GCP KG G+AL+ P K+ I+ Sbjct 89 VVFQMGTADPERALAVAKLVE-NDVAAVDVNMGCPK-EYSTKGGMGSALLSDPEKIEAIL 146 Query 77 YEMKRRVQIPVTVKCRL 93 + + + PVT K R+ Sbjct 147 TTLVKGISKPVTCKIRI 163 > xla:379349 dus3l, MGC53781; dihydrouridine synthase 3-like; K05544 tRNA-dihydrouridine synthase 3 [EC:1.-.-.-] Length=640 Score = 42.4 bits (98), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 29/77 (37%), Positives = 37/77 (48%), Gaps = 2/77 (2%) Query 20 QLGGSNPQNVAEAATWAELA-GYDEVNLNVGCPSCRVVDKGSFGAALMRSPTKVRDIVYE 78 QL G+ P + + A D V++NVGCP V KG G LM K IV Sbjct 355 QLEGAFPDTMTKCAELLNRTIDVDFVDINVGCPIDLVYKKGG-GCGLMNRTNKFEQIVKG 413 Query 79 MKRRVQIPVTVKCRLGV 95 M + +P+TVK R GV Sbjct 414 MNSVLDVPLTVKIRTGV 430 > hsa:54920 DUS2L, DUS2, FLJ20399, SMM1, URLC8; dihydrouridine synthase 2-like, SMM1 homolog (S. cerevisiae); K05543 tRNA-dihydrouridine synthase 2 [EC:1.-.-.-] Length=493 Score = 42.4 bits (98), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 27/79 (34%), Positives = 42/79 (53%), Gaps = 6/79 (7%) Query 17 IVCQLGGSNPQNVAEAATWAE--LAGYDEVNLNVGCPSCRVVDKGSFGAALMRSPTKVRD 74 +V Q+G S+ + A E +AG D +N+GCP + KG GAAL+ P K+ Sbjct 84 VVFQMGTSDAERALAVARLVENDVAGID---VNMGCPK-QYSTKGGMGAALLSDPDKIEK 139 Query 75 IVYEMKRRVQIPVTVKCRL 93 I+ + + + PVT K R+ Sbjct 140 ILSTLVKGTRRPVTCKIRI 158 > mmu:68730 Dus1l, 1110032N12Rik; dihydrouridine synthase 1-like (S. cerevisiae); K05542 tRNA-dihydrouridine synthase 1 [EC:1.-.-.-] Length=475 Score = 42.4 bits (98), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 27/96 (28%), Positives = 49/96 (51%), Gaps = 6/96 (6%) Query 1 SQYRTHTLGFD--DVEHPIVCQLGGSNPQNVAEAATWAELAGY-DEVNLNVGCPSCRVVD 57 + YR L D + P++ Q ++P+ +AA A+ Y D ++LN+GCP + Sbjct 58 ANYRKENLYCDVCPEDRPLIVQFCANDPEVFVQAALLAQ--DYCDAIDLNLGCPQ-MIAK 114 Query 58 KGSFGAALMRSPTKVRDIVYEMKRRVQIPVTVKCRL 93 +G +GA L ++ ++ R+ +PVT K R+ Sbjct 115 RGHYGAFLQEEWDLLQRMILLAHERLSVPVTCKIRV 150 > cel:F36A2.2 hypothetical protein; K05542 tRNA-dihydrouridine synthase 1 [EC:1.-.-.-] Length=527 Score = 42.0 bits (97), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 27/107 (25%), Positives = 51/107 (47%), Gaps = 2/107 (1%) Query 3 YRTHTLGFDDVEHPIVCQLGGSNPQNVAEAATWAELAGYDEVNLNVGCPSCRVVDKGSFG 62 YR ++L + P+V Q + A E D V+LN+GCP V +G +G Sbjct 116 YRRNSLALVKADRPLVVQFCANKVDTFLAACRLVEDVC-DGVDLNLGCPQM-VAKRGRYG 173 Query 63 AALMRSPTKVRDIVYEMKRRVQIPVTVKCRLGVDNLDSPEFTKQFVE 109 + L + ++V ++ ++P++ K R+ D + E+ K+ V+ Sbjct 174 SWLQDEVDLICEMVSAVRDYCRLPISCKIRVRDDRQQTVEYAKRLVD 220 > ath:AT4G38890 dihydrouridine synthase family protein; K05544 tRNA-dihydrouridine synthase 3 [EC:1.-.-.-] Length=700 Score = 42.0 bits (97), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 28/86 (32%), Positives = 47/86 (54%), Gaps = 6/86 (6%) Query 20 QLGGSNPQNVAEAATWAELA-GYDEVNLNVGCPSCRVVDKGSFGAALMRSPTKVRDIVYE 78 Q+ GS P V+ + D +++N+GCP VV+K S G+AL+ P ++++IV Sbjct 407 QICGSYPDTVSRVVELIDRECTVDFIDINMGCPIDMVVNK-SAGSALLNKPLRMKNIVEV 465 Query 79 MKRRVQIPVTVKCRL----GVDNLDS 100 V+ P+T+K R G + +DS Sbjct 466 SSSIVETPITIKVRTAFFEGKNRIDS 491 > mmu:66369 Dus2l, 2310016K04Rik; dihydrouridine synthase 2-like (SMM1, S. cerevisiae); K05543 tRNA-dihydrouridine synthase 2 [EC:1.-.-.-] Length=493 Score = 41.6 bits (96), Expect = 6e-04, Method: Compositional matrix adjust. Identities = 27/79 (34%), Positives = 40/79 (50%), Gaps = 6/79 (7%) Query 17 IVCQLGGSNPQNVAEAATWAE--LAGYDEVNLNVGCPSCRVVDKGSFGAALMRSPTKVRD 74 +V Q+G S+ + A E +AG D +N+GCP KG GAAL+ P K+ Sbjct 84 VVFQMGTSDAERALAVARLVENDVAGID---VNMGCPK-EYSTKGGMGAALLSDPDKIEK 139 Query 75 IVYEMKRRVQIPVTVKCRL 93 I+ + + PVT K R+ Sbjct 140 ILSTLVKGTHRPVTCKIRI 158 > mmu:224907 Dus3l, AI662135, AW557805, MGC56820; dihydrouridine synthase 3-like (S. cerevisiae); K05544 tRNA-dihydrouridine synthase 3 [EC:1.-.-.-] Length=637 Score = 41.6 bits (96), Expect = 7e-04, Method: Compositional matrix adjust. Identities = 29/77 (37%), Positives = 39/77 (50%), Gaps = 2/77 (2%) Query 20 QLGGSNPQNVAEAATWA-ELAGYDEVNLNVGCPSCRVVDKGSFGAALMRSPTKVRDIVYE 78 QL G+ P + + A D V++NVGCP V KG G ALM K + IV Sbjct 352 QLEGAFPDTMTKCAELLNRTIDVDFVDINVGCPIDLVYKKGG-GCALMNRSAKFQQIVRG 410 Query 79 MKRRVQIPVTVKCRLGV 95 + + +P+TVK R GV Sbjct 411 VNEVLDVPLTVKMRTGV 427 > xla:446385 dus1l, MGC83715; dihydrouridine synthase 1-like; K05542 tRNA-dihydrouridine synthase 1 [EC:1.-.-.-] Length=464 Score = 40.4 bits (93), Expect = 0.001, Method: Compositional matrix adjust. Identities = 23/95 (24%), Positives = 49/95 (51%), Gaps = 4/95 (4%) Query 14 EHPIVCQLGGSNPQNVAEAATWAELAGY-DEVNLNVGCPSCRVVDKGSFGAALMRSPTKV 72 + P++ Q ++P+ +AA A+ Y D ++LN+GCP + +G +GA L + Sbjct 67 DRPLIVQFCANDPEVFVQAALLAQ--DYCDAIDLNLGCPQ-MIAKRGHYGAFLQDEWDLL 123 Query 73 RDIVYEMKRRVQIPVTVKCRLGVDNLDSPEFTKQF 107 ++ +++ +PVT K R+ + + ++ K Sbjct 124 EKMIQLAHQKLSVPVTCKIRVFPEMEKTVQYAKML 158 > xla:432319 MGC132093; hypothetical protein MGC78973; K05542 tRNA-dihydrouridine synthase 1 [EC:1.-.-.-] Length=465 Score = 40.4 bits (93), Expect = 0.002, Method: Compositional matrix adjust. Identities = 22/94 (23%), Positives = 48/94 (51%), Gaps = 2/94 (2%) Query 14 EHPIVCQLGGSNPQNVAEAATWAELAGYDEVNLNVGCPSCRVVDKGSFGAALMRSPTKVR 73 + P++ Q ++P+ +AA A+ D ++LN+GCP + +G +G+ L + Sbjct 67 DRPLIVQFCANDPEVFVQAALLAQ-DYCDAIDLNLGCPQ-MIAKRGHYGSFLQDEWDLLE 124 Query 74 DIVYEMKRRVQIPVTVKCRLGVDNLDSPEFTKQF 107 ++ +++ +PVT K R+ + + E+ K Sbjct 125 KMIQLAHQKLSVPVTCKIRVFPEIEKTVEYAKML 158 > xla:734320 dus4l; dihydrouridine synthase 4-like; K05545 tRNA-dihydrouridine synthase 4 [EC:1.-.-.-] Length=308 Score = 40.0 bits (92), Expect = 0.002, Method: Compositional matrix adjust. Identities = 23/84 (27%), Positives = 45/84 (53%), Gaps = 5/84 (5%) Query 16 PIVCQLGGSNPQNVAEAATWAELAGYDEVNLNVGCPSCRVVDKGSFGAALMRSPTKVRDI 75 P++ Q Q +A+AA+ ++LN GCP + +G +GA L+ +P V D+ Sbjct 73 PLIVQFAAKEAQVLADAASLVSPFA-SGIDLNCGCPQRWAMAEG-YGACLINNPELVSDM 130 Query 76 VYEMKRRV---QIPVTVKCRLGVD 96 V +++ +V + +++K R+ D Sbjct 131 VRQVRNQVGSSEFTISIKIRIHAD 154 > sce:YNR015W SMM1, DUS2; Dihydrouridine synthase, member of a family of dihydrouridine synthases including Dus1p, Smm1p, Dus3p, and Dus4p; modifies uridine residues at position 20 of cytoplasmic tRNAs (EC:1.-.-.-); K05543 tRNA-dihydrouridine synthase 2 [EC:1.-.-.-] Length=384 Score = 39.7 bits (91), Expect = 0.002, Method: Compositional matrix adjust. Identities = 28/97 (28%), Positives = 51/97 (52%), Gaps = 10/97 (10%) Query 17 IVCQLGGSNPQNVAEAATWAELAGYDEVNLNVGCPSCRVVDKGSFGAALMRSPTKVRDIV 76 ++ Q+G ++P +A A + +++N GCP + G G+AL+R+P + I+ Sbjct 85 LIFQIGSASPA-LATQAALKVINDVSGIDINAGCPKHFSIHSG-MGSALLRTPDTLCLIL 142 Query 77 YEMKRRV----QIPVTVKCRLGVDNLDSPEFTKQFVE 109 E+ + V P++VK RL LD+ + T Q V+ Sbjct 143 KELVKNVGNPHSKPISVKIRL----LDTKQDTLQLVK 175 > hsa:64118 DUS1L, DUS1, PP3111; dihydrouridine synthase 1-like (S. cerevisiae); K05542 tRNA-dihydrouridine synthase 1 [EC:1.-.-.-] Length=473 Score = 39.3 bits (90), Expect = 0.003, Method: Compositional matrix adjust. Identities = 22/81 (27%), Positives = 44/81 (54%), Gaps = 4/81 (4%) Query 14 EHPIVCQLGGSNPQNVAEAATWAELAGY-DEVNLNVGCPSCRVVDKGSFGAALMRSPTKV 72 + P++ Q ++P+ +AA A+ Y D ++LN+GCP + +G +GA L + Sbjct 73 DRPLIVQFCANDPEVFVQAALLAQ--DYCDAIDLNLGCPQ-MIAKRGHYGAFLQDEWDLL 129 Query 73 RDIVYEMKRRVQIPVTVKCRL 93 + ++ ++ +PVT K R+ Sbjct 130 QRMILLAHEKLSVPVTCKIRV 150 > dre:393647 MGC63779; zgc:63779; K05544 tRNA-dihydrouridine synthase 3 [EC:1.-.-.-] Length=660 Score = 39.3 bits (90), Expect = 0.003, Method: Compositional matrix adjust. Identities = 23/54 (42%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Query 42 DEVNLNVGCPSCRVVDKGSFGAALMRSPTKVRDIVYEMKRRVQIPVTVKCRLGV 95 D V++N GCP V KG G LM +K IV M + +P+TVK R GV Sbjct 398 DFVDINSGCPIDLVYKKGG-GCGLMTRTSKFEQIVRGMNSVLDVPLTVKIRTGV 450 > tgo:TGME49_072570 hypothetical protein Length=668 Score = 38.5 bits (88), Expect = 0.006, Method: Compositional matrix adjust. Identities = 19/32 (59%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Query 44 VNLNVGCPSCRVVDKGSFGAALMRSPTKVRDI 75 VNLN GCPS RV KGSFG LM P +V ++ Sbjct 213 VNLNCGCPSPRVA-KGSFGLILMEDPKRVAEM 243 > mmu:71916 Dus4l, 2310069P03Rik, 2700089B10Rik, AI482040, MGC130363, Pp35; dihydrouridine synthase 4-like (S. cerevisiae); K05545 tRNA-dihydrouridine synthase 4 [EC:1.-.-.-] Length=324 Score = 38.1 bits (87), Expect = 0.008, Method: Compositional matrix adjust. Identities = 23/84 (27%), Positives = 46/84 (54%), Gaps = 5/84 (5%) Query 16 PIVCQLGGSNPQNVAEAATWAELAGYDEVNLNVGCPSCRVVDKGSFGAALMRSPTKVRDI 75 P++ Q ++ + +++AA + +++N GCP + G +GA L+ P V D+ Sbjct 83 PLIVQFAANDARLLSDAALLV-CPYANGIDINCGCPQRWAMADG-YGACLINKPELVHDM 140 Query 76 VYEMKRRVQIP---VTVKCRLGVD 96 V +++ RV+ P V++K R+ D Sbjct 141 VRQVRNRVESPRFSVSIKIRIHDD 164 > dre:322715 dus1l, wu:fb71f06, zgc:63748; dihydrouridine synthase 1-like (S. cerevisiae); K05542 tRNA-dihydrouridine synthase 1 [EC:1.-.-.-] Length=479 Score = 37.4 bits (85), Expect = 0.013, Method: Compositional matrix adjust. Identities = 23/96 (23%), Positives = 47/96 (48%), Gaps = 6/96 (6%) Query 1 SQYRTHTL--GFDDVEHPIVCQLGGSNPQNVAEAATWAELAGY-DEVNLNVGCPSCRVVD 57 + YR L + + P++ Q ++P+ +AA A+ Y D ++LN+GCP + Sbjct 58 ANYRRENLYSEVNQEDRPLITQFCANDPEVFIQAALLAQ--DYCDAIDLNLGCPQ-MIAK 114 Query 58 KGSFGAALMRSPTKVRDIVYEMKRRVQIPVTVKCRL 93 +G +G L + ++ ++ +P+T K R+ Sbjct 115 RGHYGVFLQDEWDLLEKMIKLANEKLSVPITCKIRV 150 > dre:100330185 dihydrouridine synthase 1-like (S. cerevisiae)-like; K05542 tRNA-dihydrouridine synthase 1 [EC:1.-.-.-] Length=496 Score = 37.0 bits (84), Expect = 0.014, Method: Compositional matrix adjust. Identities = 23/96 (23%), Positives = 47/96 (48%), Gaps = 6/96 (6%) Query 1 SQYRTHTL--GFDDVEHPIVCQLGGSNPQNVAEAATWAELAGY-DEVNLNVGCPSCRVVD 57 + YR L + + P++ Q ++P+ +AA A+ Y D ++LN+GCP + Sbjct 75 ANYRRENLYSEVNQEDRPLITQFCANDPEVFIQAALLAQ--DYCDAIDLNLGCPQ-MIAK 131 Query 58 KGSFGAALMRSPTKVRDIVYEMKRRVQIPVTVKCRL 93 +G +G L + ++ ++ +P+T K R+ Sbjct 132 RGHYGVFLQDEWDLLEKMIKLANEKLSVPITCKIRV 167 > hsa:11062 DUS4L, DUS4, MGC133233, PP35; dihydrouridine synthase 4-like (S. cerevisiae); K05545 tRNA-dihydrouridine synthase 4 [EC:1.-.-.-] Length=317 Score = 36.6 bits (83), Expect = 0.018, Method: Compositional matrix adjust. Identities = 22/84 (26%), Positives = 48/84 (57%), Gaps = 5/84 (5%) Query 16 PIVCQLGGSNPQNVAEAATWAELAGYDEVNLNVGCPSCRVVDKGSFGAALMRSPTKVRDI 75 P++ Q ++ + +++AA + +++N GCP + +G +GA L+ P V+D+ Sbjct 83 PLIVQFAANDARLLSDAARIV-CPYANGIDINCGCPQRWAMAEG-YGACLINKPELVQDM 140 Query 76 VYEMKRRVQIP---VTVKCRLGVD 96 V +++ +V+ P V++K R+ D Sbjct 141 VKQVRNQVETPGFSVSIKIRIHDD 164 > tgo:TGME49_028080 hypothetical protein ; K05544 tRNA-dihydrouridine synthase 3 [EC:1.-.-.-] Length=1220 Score = 35.8 bits (81), Expect = 0.036, Method: Compositional matrix adjust. Identities = 22/76 (28%), Positives = 37/76 (48%), Gaps = 3/76 (3%) Query 20 QLGGSNPQ--NVAEAATWAELAGYDEVNLNVGCPSCRVVDKGSFGAALMRSPTKVRDIVY 77 Q+ G P+ N +E D ++LN CP ++ + GA ++ P ++ +V Sbjct 879 QIAGGTPEVLNACTDILASEDVSCDFIDLNAACPLVQLHRRFKAGACMLDHPKRLESLVE 938 Query 78 EM-KRRVQIPVTVKCR 92 M R ++PVTVK R Sbjct 939 SMTTRHPEVPVTVKLR 954 > sce:YLR401C DUS3; Dihydrouridine synthase, member of a widespread family of conserved proteins including Smm1p, Dus1p, and Dus4p; contains a consensus oleate response element (ORE) in its promoter region (EC:1.-.-.-); K05544 tRNA-dihydrouridine synthase 3 [EC:1.-.-.-] Length=668 Score = 35.4 bits (80), Expect = 0.042, Method: Compositional matrix adjust. Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 2/54 (3%) Query 43 EVNLNVGCPSCRVVDKGSFGAALMRSPTKVRDIVYEMKRRVQ-IPVTVKCRLGV 95 E+NLN GCP + +GS G+AL+ +P ++ + M + IP+TVK R G Sbjct 379 EINLNSGCPIDLLYRQGS-GSALLDNPARMIRCLNAMNYVSKDIPITVKIRTGT 431 > cel:Y37E11B.5 hypothetical protein; K05544 tRNA-dihydrouridine synthase 3 [EC:1.-.-.-] Length=554 Score = 34.7 bits (78), Expect = 0.074, Method: Compositional matrix adjust. Identities = 28/93 (30%), Positives = 47/93 (50%), Gaps = 6/93 (6%) Query 20 QLGGSNPQNVAEAATWA-ELAGYDEVNLNVGCPSCRVVDKGSFGAALMRSPTKVRDIVYE 78 QL G +A+A+ E D +++N+GCP VV++ G AL P K+ +++ Sbjct 264 QLAGGFADTMAKASQIVVENFDVDFIDINMGCP-IDVVNQKGGGCALPSRPQKLFEVLAA 322 Query 79 MKRRVQ--IPVTVKCRLGVDN--LDSPEFTKQF 107 K + P+TVK R G+ L +PE+ + Sbjct 323 TKSVLGGCCPLTVKIRTGMKEGVLKAPEYVEHM 355 > hsa:1806 DPYD, DHP, DHPDHASE, DPD, MGC132008, MGC70799; dihydropyrimidine dehydrogenase (EC:1.3.1.2); K00207 dihydropyrimidine dehydrogenase (NADP+) [EC:1.3.1.2] Length=1025 Score = 33.5 bits (75), Expect = 0.17, Method: Compositional matrix adjust. Identities = 23/76 (30%), Positives = 37/76 (48%), Gaps = 2/76 (2%) Query 25 NPQNVAEAATWAELAGYDEVNLNVGCPSCRVVDKGSFGAALMRSPTKVRDIVYEMKRRVQ 84 N + E A +E +G D + LN+ CP + + G A + P VR+I +++ VQ Sbjct 646 NKNDWTELAKKSEDSGADALELNLSCP--HGMGERGMGLACGQDPELVRNICRWVRQAVQ 703 Query 85 IPVTVKCRLGVDNLDS 100 IP K V ++ S Sbjct 704 IPFFAKLTPNVTDIVS 719 > mmu:99586 Dpyd, AI315208, DPD, E330028L06Rik, MGC37940; dihydropyrimidine dehydrogenase (EC:1.3.1.2); K00207 dihydropyrimidine dehydrogenase (NADP+) [EC:1.3.1.2] Length=1025 Score = 32.7 bits (73), Expect = 0.32, Method: Compositional matrix adjust. Identities = 21/76 (27%), Positives = 37/76 (48%), Gaps = 2/76 (2%) Query 25 NPQNVAEAATWAELAGYDEVNLNVGCPSCRVVDKGSFGAALMRSPTKVRDIVYEMKRRVQ 84 N + E + AE +G D + LN+ CP + + G A + P VR+I +++ V+ Sbjct 646 NKSDWMELSKMAEASGADALELNLSCP--HGMGERGMGLACGQDPELVRNICRWVRQAVR 703 Query 85 IPVTVKCRLGVDNLDS 100 +P K V ++ S Sbjct 704 VPFFAKLTPNVTDIVS 719 > cel:C25F6.3 dpyd-1; DihydroPYrimidine Dehydrogenase family member (dpyd-1); K00207 dihydropyrimidine dehydrogenase (NADP+) [EC:1.3.1.2] Length=1059 Score = 32.3 bits (72), Expect = 0.41, Method: Compositional matrix adjust. Identities = 23/62 (37%), Positives = 35/62 (56%), Gaps = 2/62 (3%) Query 25 NPQNVAEAATWAELAGYDEVNLNVGCPSCRVVDKGSFGAALMRSPTKVRDIVYEMKRRVQ 84 N + E AT +E AG D + LN+ CP + +KG G A +SP V++I ++ V+ Sbjct 660 NKADWIELATKSEEAGADILELNLSCPH-GMGEKG-MGLACGQSPEIVKEICRWVRACVK 717 Query 85 IP 86 IP Sbjct 718 IP 719 > xla:447312 dpyd, MGC81821, dhp, dhpdhase, dpd; dihydropyrimidine dehydrogenase (EC:1.3.1.2); K00207 dihydropyrimidine dehydrogenase (NADP+) [EC:1.3.1.2] Length=940 Score = 32.0 bits (71), Expect = 0.55, Method: Compositional matrix adjust. Identities = 24/84 (28%), Positives = 41/84 (48%), Gaps = 3/84 (3%) Query 8 LGFDDVEHPIVCQLGGS-NPQNVAEAATWAELAGYDEVNLNVGCPSCRVVDKGSFGAALM 66 L D +H I+ + S N + E + AE +G + + LN+ CP + + G A Sbjct 628 LKADFPKHIIIASIMCSYNKDDWTELSLMAEASGANALELNLSCP--HGMGERGMGLACG 685 Query 67 RSPTKVRDIVYEMKRRVQIPVTVK 90 + P VR+I +++ V+IP K Sbjct 686 QDPELVRNICRWVRQAVKIPFFAK 709 > eco:b2147 yeiA, dpdB, ECK2140, JW2134; dihydropyrimidine dehydrogenase, NADH-dependent, subunit B Length=411 Score = 31.2 bits (69), Expect = 0.84, Method: Compositional matrix adjust. Identities = 19/74 (25%), Positives = 32/74 (43%), Gaps = 3/74 (4%) Query 17 IVCQLGGSNPQNVAEAATWAELAGYDEVNLNVGCPSCRVVDKGSFGAALMRSPTKVRDIV 76 ++ + G N Q E A + AG D + N CP + + G+ + +SP V Sbjct 104 LIASIMGENEQQWEELARLVQEAGADMIECNFSCPQ---MTSHAMGSDVGQSPELVEKYC 160 Query 77 YEMKRRVQIPVTVK 90 +KR +P+ K Sbjct 161 RAVKRGSTLPMLAK 174 > dre:556707 hypothetical LOC556707 Length=499 Score = 30.8 bits (68), Expect = 1.0, Method: Compositional matrix adjust. Identities = 24/96 (25%), Positives = 36/96 (37%), Gaps = 5/96 (5%) Query 7 TLGFDDVEHPIVCQLGGSNPQNVAEAATWAELAGYDEVNLNVGCPSCRVVDKGSFGAALM 66 L D P+ + S A +W L +DE +N C ++D + Sbjct 132 ALKLHDRNQPVTLDMRHS-----ALCHSWLSLRLFDEGTINKWKDCCTMIDHANGATNYF 186 Query 67 RSPTKVRDIVYEMKRRVQIPVTVKCRLGVDNLDSPE 102 SPT V D YE V + K + GV ++ E Sbjct 187 FSPTLVADWFYESISMVLAEIQKKPQRGVPRVEKVE 222 > dre:405829 dpyd, MGC77205, zgc:77205; dihydropyrimidine dehydrogenase (EC:1.3.1.2); K00207 dihydropyrimidine dehydrogenase (NADP+) [EC:1.3.1.2] Length=1022 Score = 30.8 bits (68), Expect = 1.1, Method: Compositional matrix adjust. Identities = 26/95 (27%), Positives = 39/95 (41%), Gaps = 16/95 (16%) Query 18 VCQLGGSNPQNVAEA--------ATWAELAGY------DEVNLNVGCPSCRVVDKGSFGA 63 V +L P+N+ A A W ELA D + LN+ CP + + G Sbjct 625 VAELKADFPKNIIIASIMCSYNQADWTELAKMAQESQADALELNLSCP--HGMGERGMGL 682 Query 64 ALMRSPTKVRDIVYEMKRRVQIPVTVKCRLGVDNL 98 A + P VR+I +++ IP K V N+ Sbjct 683 ACGQDPELVRNICRWVRKATSIPFFAKLTPNVTNI 717 Lambda K H 0.319 0.135 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2072286120 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40