bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_8423_orf4 Length=155 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_082230 sulfate adenylyltransferas-adenylylsulfate k... 61.6 9e-10 hsa:10384 BTN3A3, BTF3; butyrophilin, subfamily 3, member A3; ... 33.1 0.37 dre:368728 heatr5a, CG2747, KIAA1316, MGC63665, si:busm1-142b2... 30.4 2.5 tgo:TGME49_052370 hypothetical protein 30.0 3.2 hsa:23138 N4BP3, KIAA0341; NEDD4 binding protein 3 29.6 > tgo:TGME49_082230 sulfate adenylyltransferas-adenylylsulfate kinase, putative (EC:2.7.7.4 2.7.1.25); K00958 sulfate adenylyltransferase [EC:2.7.7.4] Length=607 Score = 61.6 bits (148), Expect = 9e-10, Method: Composition-based stats. Identities = 34/68 (50%), Positives = 43/68 (63%), Gaps = 5/68 (7%) Query 90 AAAAFPRGAAAFPRGAAAQ----VGTVIAELGVESVYLPDLEEEMEKVLGTTDANHPYVK 145 A A +P A +GA + VGTVI EL V SV+ PDL+ E + VLGTTDANHPYV Sbjct 105 ACAKYPSDCPA-AQGAVIKLRNNVGTVIVELKVSSVFEPDLQWEQQLVLGTTDANHPYVD 163 Query 146 YLRENHSE 153 Y+ N+ + Sbjct 164 YMNTNYRD 171 > hsa:10384 BTN3A3, BTF3; butyrophilin, subfamily 3, member A3; K06712 butyrophilin Length=584 Score = 33.1 bits (74), Expect = 0.37, Method: Compositional matrix adjust. Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 4/63 (6%) Query 26 ASAGLGESSLLRNLLLLLQQRARLRRRSSAAAAFLRAAAAFLRGAAAFLRAAAAFLRGAA 85 S+G G S ++RN LL L++ A + S A F R+A ++ A L + L GA+ Sbjct 212 GSSGGGVSCIIRNSLLGLEKTASI----SIADPFFRSAQPWIAALAGTLPISLLLLAGAS 267 Query 86 AFL 88 FL Sbjct 268 YFL 270 > dre:368728 heatr5a, CG2747, KIAA1316, MGC63665, si:busm1-142b24.3, si:dz142b24.3, zgc:63665; HEAT repeat containing 5a Length=1998 Score = 30.4 bits (67), Expect = 2.5, Method: Compositional matrix adjust. Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 0/37 (0%) Query 51 RRSSAAAAFLRAAAAFLRGAAAFLRAAAAFLRGAAAF 87 +RSS ++ FLRG A FLRA+ L+G ++ Sbjct 263 KRSSLEEVMELLSSGFLRGGAGFLRASGDMLKGTSSV 299 > tgo:TGME49_052370 hypothetical protein Length=1990 Score = 30.0 bits (66), Expect = 3.2, Method: Compositional matrix adjust. Identities = 28/99 (28%), Positives = 44/99 (44%), Gaps = 5/99 (5%) Query 23 RPHASAGLGESSLLRNLLLLLQQRARLRRRSSAAAAFLRAAAAFLRGAAAFLRAAAAFLR 82 RP ++G+ E + ++ + LR R +AA AA RG AAF+R ++ + Sbjct 1696 RPKEASGMSEPHMGLSVSGGCRHETSLRWRGGDSAAHQNIYAAGFRGRAAFMRVPSSAVH 1755 Query 83 GAAAFLQAAAAFPRGAAAFPRGAAAQVGTVIAELGVESV 121 AA ++A P A G A G + L +E V Sbjct 1756 PPAAL---SSAVPSSVLAT--GVAPAPGAALGTLSMEGV 1789 > hsa:23138 N4BP3, KIAA0341; NEDD4 binding protein 3 Length=544 Score = 29.6 bits (65), Expect = 4.4, Method: Compositional matrix adjust. Identities = 11/32 (34%), Positives = 19/32 (59%), Gaps = 0/32 (0%) Query 123 LPDLEEEMEKVLGTTDANHPYVKYLRENHSEW 154 LP+ EE+++ LG D ++P+ + L E W Sbjct 262 LPETCEELKRGLGDEDGSNPFTQVLEERQRLW 293 Lambda K H 0.323 0.133 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 3386671600 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40